cox12

Cytochrome c oxidase subunit 6B

86 amino acids

This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. This protein may be one of the heme-binding subunits of the oxidase (By similarity).

Belongs to the cytochrome c oxidase subunit 6B family.

10.264 kDa

MSEQEDQEAPKQFTFGTVGFDARFPNTNQTKHCFQSYIDYFRCIKAKGEDFVPCKQFWHAYQSLCPMEWVERWDEQRENGTFPAPI

COX12

Cytochrome c oxidase subunit 6B

83 amino acids

This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. This protein may be one of the heme-binding subunits of the oxidase.

Belongs to the cytochrome c oxidase subunit 6B family.

9.788 kDa

MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD