cox-2

Cytochrome c oxidase subunit 2

250 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.555 kDa

MGLLFNNLIMNFDAPSPWGIYFQDSATPQMEGLVELHDNIMYYLVVILFGVGWILLSIIRNYISTKSPISHKYLNHGTLIELIWTITPAVILILIAFPSFKLLYLMDEVSDPSMSVLAEGHQWYWSYQYPDFLDSNDEFIEFDSYIVPESDLEEGALRMLEVDNRVILPELTHVRFIITAGDVIHSFAVPSLGVKCDAYPGRLNQVSVFINREGVFYGQCSEICGILHSSMPIVIESVSLEKFLTWLEEQ

cox-2

Cytochrome c oxidase subunit 2

231 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

26.59 kDa

MNNFFQGYNLLFQHSLFASYMDWFHAFNCSLLLGVLVFVTLLFGYLIFSTFYFKSKKIEYQFGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLDSNLTVKVTGHQWYWSYEYSDIPGLEFDSYMKSLDQLNLGEPRLLEVDNRCVIPCDTNIRFCITSADVIHAWALNSLSVKLDAMSGILSTFSYSFPMVGVFYGQCSEICGANHSFMPIALEVTLLDNFKSWCFGTME

cox-2

Cytochrome c oxidase subunit 2

230 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

26.459 kDa

single

NNFFQGYNLLFQHSLFASYMDWFHAFNCSLLLGVLVFVTLLFGYLIFSTFYFKSKKIEYQFGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLDSNLTVKVTGHQWYWSYEYSDIPGLEFDSYMKSLDQLNLGEPRLLEVDNRCVIPCDTNIRFCITSADVIHAWALNSLSVKLDAMSGILSTFSYSFPMVGVFYGQCSEICGANHSFMPIALEVTLLDNFKSWCFGTME