Protein
CRISPR system CMR subunit Cmr1
Organism
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Function
CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA) (By similarity). The CMR complex degrades RNA complementary to the crRNA (target RNA) within UA dinucleotides, generating 3'-OH and 5'-phosphate ends. Activity is dependent on the 8 nt long 5' tag in the crRNA, an unpaired 3' flag on the target RNA, and is stimulated by ATP. Some cleavage of the guide crRNA can also be observed.
Similarity
Belongs to the CRISPR system Cmr1 family.
Sequence
MEELLMSFKLKAIYPLTGGYNRHSINEFYEENVRPTEIKGLWRWWNRVLFNTVSYVKEGKLYTYDSIDRLFEDVFGSENKKSAVRLEVITDEGSDNHFELSNVELDNVIDCLKANREEKVNLDFRDNTLIIEIEGSTKIPISFKSNLDIDKIKDLVYKNKLLSFELLGFKSIKIDTKISDKEVIKEILRDLITNYLEYFNIKQEVTFTLNIYLDKSLKHKQNFDAKLKFALHSLLVFILLGGIGRKTSRGFGGLSIVNAECHDGLCGEIYGIVNNMESEKEKKDLATVLPNIIFSQTIEQYFSELINNESYKLRSWNNNSDFFVYYFIKDINILRINRIDTNVNRNGIENILNRISNELSASGNCLKDLIMQEMRRRAFALAFLGNRKFRNIHEIYPRILEFLYANYIKREFVNLIGKERRLSNLRFKILEINNTYYIISYLLYSSYLKDPNSSIKDTLYQFARCVI