About Products Protein Database Contact

cmk-1

Gene
cmk-1
Protein
Calcium/calmodulin-dependent protein kinase type 1
Organism
Caenorhabditis briggsae
Length
356 amino acids
Function
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade which results in transcriptional activation. Transcriptional activation occurs at least in part through phosphorylation of crh-1. Regulates gene expression, sensory morphology, and function of the AFD thermosensory neurons. Involved in long-term adaptation of AFD neurons to temperatures warmer than the initial acclimatized cultivation temperature. Acts in the FLP thermal nociceptors to moderate the responsiveness to noxious heat and controls neuropeptide release from FLP neurons in response to temperature elevations. Regulates the dauer decision, the decision of the larvae to enter into the alternative stress-resistant and long-lived dauer developmental stage, based on the feeding state, primarily in the AWC sensory neurons. Acts non cell-autonomously in the AWC neurons to regulate expression of the daf-28 insulin-like peptide and cell-autonomously in the ASI sensory neurons to regulate expression of the growth promoting daf-7 in a food-regulated manner. Plays a role in memory-based thermal response of an individual AFD neuron cell. Involved in chemotaxis response in AWC neurons to attractant 2-heptanone, a volatile organic compound emitted by the nematode pathogenic bacterium B.nematocida B16. Represses transcription of glutamate receptor glr-1 in the nucleus basally and in response to change in synaptic activity.
Similarity
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Mass
40.532 kDa
Sequence
MPLFKRRDVNTPAPTSSIREKYDFRDVLGTGAFSKVFLAESKTDVGQLYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFETYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVSFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFISHLMCCDPEMRFTCQSALEHPWISGNTAYTHDIHRTVAVHLKKSLAKRNWKKAFNAAAAIRQLQLLRLSPIATAFRNKRPNSNQRLQLPNVLVFQYFCKIP

Gene
cmk-1
Protein
Calcium/calmodulin-dependent protein kinase type 1
Organism
Caenorhabditis briggsae
Length
356 amino acids
Function
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade which results in transcriptional activation. Transcriptional activation occurs at least in part through phosphorylation of crh-1. Regulates gene expression, sensory morphology, and function of the AFD thermosensory neurons. Involved in long-term adaptation of AFD neurons to temperatures warmer than the initial acclimatized cultivation temperature. Acts in the FLP thermal nociceptors to moderate the responsiveness to noxious heat and controls neuropeptide release from FLP neurons in response to temperature elevations. Regulates the dauer decision, the decision of the larvae to enter into the alternative stress-resistant and long-lived dauer developmental stage, based on the feeding state, primarily in the AWC sensory neurons. Acts non cell-autonomously in the AWC neurons to regulate expression of the daf-28 insulin-like peptide and cell-autonomously in the ASI sensory neurons to regulate expression of the growth promoting daf-7 in a food-regulated manner. Plays a role in memory-based thermal response of an individual AFD neuron cell. Involved in chemotaxis response in AWC neurons to attractant 2-heptanone, a volatile organic compound emitted by the nematode pathogenic bacterium B.nematocida B16. Represses transcription of glutamate receptor glr-1 in the nucleus basally and in response to change in synaptic activity.
Similarity
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Mass
40.532 kDa
Sequence
MPLFKRRDVNTPAPTSSIREKYDFRDVLGTGAFSKVFLAESKTDVGQLYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFETYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVSFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFISHLMCCDPEMRFTCQSALEHPWISGNTAYTHDIHRTVAVHLKKSLAKRNWKKAFNAAAAIRQLQLLRLSPIATAFRNKRPNSNQRLQLPNVLVFQYFCKIP

Gene
cmk-1
Protein
Calcium/calmodulin-dependent protein kinase type 1
Organism
Caenorhabditis elegans
Length
348 amino acids
Function
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade which results in transcriptional activation (PubMed:10428833, PubMed:12231504, PubMed:26725111). Transcriptional activation occurs at least in part through phosphorylation of crh-1 (PubMed:10428833, PubMed:12231504). Regulates gene expression, sensory morphology, and function of the AFD thermosensory neurons (PubMed:10428833, PubMed:14711416, PubMed:25467978). Involved in long-term adaptation of AFD neurons to temperatures warmer than the initial acclimatized cultivation temperature (PubMed:25467978). Acts in the FLP thermal nociceptors to moderate the responsiveness to noxious heat and controls neuropeptide release from FLP neurons in response to temperature elevations (PubMed:25467982). Regulates the dauer decision, the decision of the larvae to enter into the alternative stress-resistant and long-lived dauer developmental stage, based on the feeding state, primarily in the AWC sensory neurons. Acts non cell-autonomously in the AWC neurons to regulate expression of the daf-28 insulin-like peptide and cell-autonomously in the ASI sensory neurons to regulate expression of the growth promoting daf-7 in a food-regulated manner (PubMed:26335407). Plays a role in memory-based thermal response of an individual AFD neuron cell (PubMed:26725111). Involved in chemotaxis response in AWC neurons to attractant 2-heptanone, a volatile organic compound emitted by the nematode pathogenic bacterium B.nematocida B16 (PubMed:27660389). Represses transcription of glutamate receptor glr-1 in the nucleus basally and in response to change in synaptic activity (PubMed:27462879).
Similarity
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Mass
39.124 kDa
Sequence
MPLFKRRDGSGPAPNATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTVAVHLKKSLAKRNWKKAYNAAAAIRQLQMLRLSSNSNRLQKQASQQQPEPPTPAFHA

Gene
cmk-1
Protein
Calcium/calmodulin-dependent protein kinase type 1
Organism
Caenorhabditis elegans
Length
348 amino acids
Function
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade which results in transcriptional activation (PubMed:10428833, PubMed:12231504, PubMed:26725111). Transcriptional activation occurs at least in part through phosphorylation of crh-1 (PubMed:10428833, PubMed:12231504). Regulates gene expression, sensory morphology, and function of the AFD thermosensory neurons (PubMed:10428833, PubMed:14711416, PubMed:25467978). Involved in long-term adaptation of AFD neurons to temperatures warmer than the initial acclimatized cultivation temperature (PubMed:25467978). Acts in the FLP thermal nociceptors to moderate the responsiveness to noxious heat and controls neuropeptide release from FLP neurons in response to temperature elevations (PubMed:25467982). Regulates the dauer decision, the decision of the larvae to enter into the alternative stress-resistant and long-lived dauer developmental stage, based on the feeding state, primarily in the AWC sensory neurons. Acts non cell-autonomously in the AWC neurons to regulate expression of the daf-28 insulin-like peptide and cell-autonomously in the ASI sensory neurons to regulate expression of the growth promoting daf-7 in a food-regulated manner (PubMed:26335407). Plays a role in memory-based thermal response of an individual AFD neuron cell (PubMed:26725111). Involved in chemotaxis response in AWC neurons to attractant 2-heptanone, a volatile organic compound emitted by the nematode pathogenic bacterium B.nematocida B16 (PubMed:27660389). Represses transcription of glutamate receptor glr-1 in the nucleus basally and in response to change in synaptic activity (PubMed:27462879).
Similarity
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Mass
39.124 kDa
Sequence
MPLFKRRDGSGPAPNATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTVAVHLKKSLAKRNWKKAYNAAAAIRQLQMLRLSSNSNRLQKQASQQQPEPPTPAFHA