CLPP3

ATP-dependent Clp protease proteolytic subunit 3, chloroplastic

309 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). In the absence of CLPP3, modified ClpPR core(s) could be formed, albeit at strongly reduced levels (PubMed:23548781).

Belongs to the peptidase S14 family.

33.925 kDa

MEMSLRLASSSTSNPICLLNPGKNLNFPIRNHRIPKTSKPFCVRSSMSLSKPPRQTLSSNWDVSSFSIDSVAQSPSRLPSFEELDTTNMLLRQRIVFLGSQVDDMTADLVISQLLLLDAEDSERDITLFINSPGGSITAGMGIYDAMKQCKADVSTVCLGLAASMGAFLLASGSKGKRYCMPNSKVMIHQPLGTAGGKATEMSIRIREMMYHKIKLNKIFSRITGKPESEIESDTDRDNFLNPWEAKEYGLIDAVIDDGKPGLIAPIGDGTPPPKTKVWDLWKVEGTKKDNTNLPSERSMTQNGYAAIE

clpP3

ATP-dependent Clp protease proteolytic subunit 3

240 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

25.987 kDa

MFSSHASLPIHSRRLAAGLDSRWQQPQIQAIAGSQAIVPTVVEQSGRGERAFDIYSRLLRERIVFLGTGVDDAVADSIVAQLLFLEAEDPEKDIQLYINSPGGSVTAGMAIYDTMQQVAPDVATICFGLAASMGAFLLSGGAQGKRMALPSARIMIHQPLGGAQGQAVDIEIQAREILYHKSTLNDLLAQHTGQPLEKIEVDTDRDFFMSPEEAKAYGLIDQVLTRPTMAITDHNDAVLQ

clpP3

ATP-dependent Clp protease proteolytic subunit 3

221 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.147 kDa

MALIDPRAGLSGIAPSSPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRADVATVCLGQAASAAAVLLAAGTPGKRACLPNARVLIHQPSLEGGIQGQVSDLEIQAAEIERMRRLMETTLARHTGKDPDTIRKDTDRDKILTAEDAKEYGIIDTVFDYRKLSAQK

clpP3

ATP-dependent Clp protease proteolytic subunit 3

219 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.205 kDa

MRRPGAVVRRAGGYVTNLMPTAAGDPIGGGLGDQVYNRLLGERIIFLGQAVDDDIANKITAQLLLLASDPDKDIYLYINSPGGSITAGMAIYDTMQYIKNDVVTIAMGMAASMGQFLLSAGTPGKRFALPNAEILIHQPSAGLAGSASDIKIHAERLLHTKKRMAELTAFHTGQTVEQVTRDSDRDRWFDPVEAKEYGLIDDIMPTAAGMPGGGGTGAA

clpP3

ATP-dependent Clp protease proteolytic subunit 3

217 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.561 kDa

MSPFTAGPAPARTPRAEEGDTPATRFDDRLAEQLLDQRIVLLGTQVDEVSANRVCAQLLILSAQDPRTDISLYVNSPGGSVHAGLAIYDTMRLIPNDVSTLAMGFAASMGQFLLSVGTAGKRYALPNARIMMHQPSAGIGGTTADIEIQADNLDFTKRTIERITAEHTGQSPETISRDGDRDRWFTAEEAREYGMVDQVVQSLADVRPAATRRRMGL

clpP3

ATP-dependent Clp protease proteolytic subunit 3

216 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.593 kDa

MINTKCIHPVQNKWKGDLPCSGPGVLPTVIEQSGRGERAFDIYSRLLRERIIFLGTDVNDQIADALVAQMLFLEAEDPEKDIQLYINSPGGSVTAGLAIYDTMQQVNPDIVTMCYGLAASMGAFLLAGGSKGKRLALPNSRIMIHQPLGGAQGQAVEIEIQAKEILFLKETLNNLLAEHTGQSLEKISEDTDRDHFLSPQEAVEYGLIDKVVNSLN

clpP3

ATP-dependent Clp protease proteolytic subunit 3

215 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.692 kDa

MYSEKKHLIQSSINSRDIDKSRSAVPTVVEQSGRGERAFDIYSRLLRERIIFLGTGINDQVSDSLVAQLLFLEAEDPHKDIQIYINSPGGSVTAGLAIYDTMQQISPDVVTICFGVAASMGAFLLSGGAKGKRLALPNSRIMIHQPLGGAQGQAVEIEIQAKEILFLKKTLNSLLAKHTNQSLEKINEDTERDYFLSPEEAVEYGLIDKVIKNDK

clpP3

ATP-dependent Clp protease proteolytic subunit 3

214 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.411 kDa

MSSHLNGIGNIVPMVVEQSGMGERAFDIYSRLLRERIIFLGTPIDDAVANTIVAQLLFLDAEDSEKDIQLYINSPGGSVYAGMAIYDTIQQIRPDVVTICFGLAASMGAFLLTAGTKGKRMSLPDSRIMIHQPLGGAQGQAIDIEIQAREILYIKAQLNQLLANHTGQPLERIEADTDRDFFMSAEEAKNYGLIDQVISRQNLPTAGENVTIVK

clpP3

ATP-dependent Clp protease proteolytic subunit 3

213 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

23.486 kDa

MLGGGAPRARHVLPNIVERTSRGEYSMDPYSKLLKERIVFLGVQIDDVSANDVMAQLLFLESEDPDRDISIYINSPGGSFTSLTAIYDTMQFVRPDISTICMGQAASAAAVLLAAGTPGKRFALENSRILIHQPSAQGEGQSSDIEIQAREILRVRALQETMLARHTGRTETEIRRDTERDKIFSADEAEEYGLIDEVIMSRKAARLLSARSA

clpP3

ATP-dependent Clp protease proteolytic subunit 3

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.853 kDa

MTTAALPDLNYRDLLADRLFRQRTILLTGEVDDAMAERACSELVLLAAADPKRDIVLYINSPGGSVFAGLAIYDTMKLVPNDVVTVAMGFAASMGQVLLCSGTHGKRISLAHSRIMMHQPSAGIGGTAVDIAIQAESLERMKRQSQEILAAETGHPVEQIAEDSDRDRWFTADEARDYGIVDRVVSSFAEIAPHTTAPRIGL

clpP3

Probable ATP-dependent Clp protease proteolytic subunit 3

202 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.397 kDa

MPIGVPSVPFRLPGSQYERWIDIYTRLSQERIIFLGQEVNDSIANRIVAFLLYLDSDDPSKPIYLYINSPGGSVTAGMAIYDTMQYIKAEVITICVGLAASMGAFLLASGAPGKRLALPHARIMIHQPMGGTGRRQATDIDIEAREILRIRQQLNEIMAQRTGQTVEKIAKDTDRDYFLSAAEAKEYGLIDKVIENSTMGNN

clpP3

ATP-dependent Clp protease proteolytic subunit 3

201 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.267 kDa

MNYAGEPLMNEDEDDKSKELPIGKETEANLFKSRSIFIYGGITQELAQKVCTQLVALAAASDDDIRVYVNSPGGHVESGDSIHDMIKFIKPKVYIIGTGWVASAGALIYVSVPKERRLCLPNTRFLLHQPSGGTRGMASDIEIQAREIIKMNQRLIKIFSKATGQTEEKIAKDIDRDYWLSADDAKDYGLVGKIVESQSEL

clpP3

ATP-dependent Clp protease proteolytic subunit 3

200 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.062 kDa

MPIGTPSVPYRLPGSQMERWVDIYTRLGVERILFLGSEVNDGIANSLVAQMLYLDSEDSSKPIYLYINSPGGSVTAGLAIYDTIQYVKSEVVTICVGLAASMGAFLLAAGTKGKRVALPHSRIMIHQPLGGTSRRQASDIEIEAREILRMKEMLNRSLSDMSGQSFDKIEKDTDRDYFLSAEEAKDYGLIDRVISHPNEA

clpP3

ATP-dependent Clp protease proteolytic subunit 3

200 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.987 kDa

MPIGTPSVPYRLPGSQMERWVDIYTRLGVERILFLGSEVNDGIANSLVAQMLYLDSEDSSKPIYLYINSPGGSVTAGLAIYDTIQYVKSEVVTICVGLAASMGAFLLAAGTKGKRVALPHSRIMIHQPLGGTSRRQASDIEIEAREILRMKDMLNHSLADMSGQTFEKIEKDTDRDYFLSAEEAMAYGLIDRVISHPTEA

clpP3

ATP-dependent Clp protease proteolytic subunit 3

200 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.09 kDa

MPIGTPSVPYRLPGSQMERWVDIYTRLGVERILFLGSEVNDGIANSLVAQMLYLDSEDSSKPIYLYINSPGGSVTAGLAIYDTIQYVKSEVVTICVGLAASMGAFLLAAGTKGKRVALPHSRIMIHQPLGGTSRRQASDIEIEAREILRMKEMLNRSLSDMSGQSFEKIEKDTDRDYFLSAEEAKEYGLIDRVISHPNEA

clpP3

ATP-dependent Clp protease proteolytic subunit 3

199 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.08 kDa

MPIGVPSVPYRLPGSSFERWIDIYNRLAMERIIFLGQEVTDGLANSIVAQLLYLDSEDSSKPIYLYINSPGGSVTAGMAIYDTMQYIKSPVITICLGLAASMGAFLLCAGSKGKRLALPHSRIMIHQPLGGTGRRQASDIEIEAKEILRIKKLLNQIMADRTGQPLEKIEKDTDRDYFMSAEEAREYGLIDQVIAERPV

clpP3

Probable ATP-dependent Clp protease proteolytic subunit 3

197 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

22.185 kDa

MPIGVPKVPYRMPGGQFTDWISIYDRLYRERIIFLGRDVDDEIANQIIAVMLYLDSEDPGKDIYLYINSPGGMVTSGLAIYDTMQHIKSDVVTICVGLAASMGSFLLAAGTKGKRMALPHSRIMIHQPSGGTRGQATDIEIEAREILRIRHQLNQIYANNTSQPLAKIEKDMDRDFFMSAQEAMEYGLIDRVIEERV

clpP3

ATP-dependent Clp protease proteolytic subunit 3

197 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.808 kDa

MIPIVIEESGRGERAFDIYSRLLRERIIFLGEPVTSDSANRIVAQMLFLEAEDPEKDIYLYINSPGGSVYDGLGIFDTMQHVKPDVQTVCVGLAASMGAFLLCAGAMGKRSSLQHSRIMIHQPLGGARGQASDIRIQADEILFLKDRLNRVLADRTGQPLERIQEDTDRDFFMSPAEAVGYGLVDSVIDKRPVHSVN

clpP3

ATP-dependent Clp protease proteolytic subunit 3

195 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.567 kDa

MRNDDDQEEKKTELPLGKETEANLFKSRSIFIYGTITQELAQKVCSQLVALAAASDDDIRLFVNSPGGHVESGDSIHDMIKFVKPKVWTIGTGWVASAGALIYVAAPKEQRLCLPNTRFLLHQPSGGTRGMASDIEIQAREIIKMNERLNRIFSEATGQPVDKIAKDTDRDYWLGAEEAKAYGLVSRIVTSIAEI

clpP3

ATP-dependent Clp protease proteolytic subunit 3

194 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.135 kDa

MLPTVIEQSGQGDRAFDIYSRLLRERIIFLGTDVNDQVADALVAQMLFLEADDPEKDIQLYVNSPGGSVTAGLAIYDTMQQVSPDVITICYGLAASMGAFLLSGGTKGKRLALPNSRIMIHQPLGGAQGQAVEIEIQAKEILYLKETLNSLLAEHTGQNIQKISEDTDRDHFLSPQEAVEYGLIDKVVSNLNSI

clpP3

ATP-dependent Clp protease proteolytic subunit 3

194 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.579 kDa

MNDEEQDDKTKELPLGKETEANLFKSRSIFIYGPINQELAQKVCSQLVALAAASDEDIRIYVNSPGGHVESGDSIHDMVKFIKPKVWMIGTGWVASAGALIYVAAPRERRLCLPNTRFLLHQPSGGTRGMASDIEIQAREIIKMNERLNKIMAEATGQPLEKIAKDTDRDYWLSAEEAKDYGLVSRIVTSQADI

clpP3

ATP-dependent Clp protease proteolytic subunit 3

194 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.581 kDa

MNDEDQDDKTKELPLGKETEANLFKSRSIFIYGPINQELAQKVCSQLVALAAASDEDIRIYVNSPGGHVESGDSIHDMIKFIKPKVWMIGTGWVASAGALIYVATPKERRLCLPNTRFLLHQPSGGTRGMASDIEIQAREIIKMNERLNRIMAAATGQPLDKIDKDTDRDYWLSAEEAKDYGLVSRIVTSQADI