Protein
Short-chain dehydrogenase chyC
Organism
Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
Function
Short-chain dehydrogenase; part of the gene cluster that mediates the biosynthesis of the yellow pigment chrysogine (PubMed:29196288). the NRPS chyA mediates the condensation of anthranilic acid and alanine into the intermediate 2-(2-aminopropanamido)benzoic acid (PubMed:29196288). The remainder of the pathway is highly branched yielding at least 13 chrysogine-related compounds (PubMed:29196288). The malonyl transferase chyE converts 2-(2-aminopropanamido)benzoic acid and 2-(2-aminopropanamido)benzamidine into 2-(2-(2-carboxyacetamido)propanamido)benzoic acid and 3-((1-((2-carbamoylphenyl)amino)-1-oxopropan-2-yl)amino)-3-oxopropanoic acid, respectively (PubMed:29196288). ChyD is an amidase, being responsible for the amidation of the carboxylic acid moiety of 2-(2-aminopropanamido)benzoic acid, 2-(2-(2-carboxyacetamido)propanamido)benzoic acid and 2-(2-((4-amino-1-carboxy-4-oxobutyl)amino)propanamido)benzoic acid (PubMed:29196288). ChyC is involved in the same reactions as ChyD, but plays a more minor role in the amidation reactions compared to chyD (PubMed:29196288). The oxidoreductases chyH and chyM are involved in oxidation reactions that form N-pyruvoylanthranilamide from 2-(2-aminopropanamido)benzamidine and (1-((2-carbamoylphenyl)amino)-1-oxopropan-2-yl)glutamine, respectively (PubMed:29196288). N-pyruvoylanthranilamide is further converted via two further branches in the pathway, yielding chrysogine and additional chrysogine-related coumpounds (PubMed:29196288). Chrysogine is likely formed by a spontaneous ring closure from N-pyruvoylanthranilamide (PubMed:29196288).
Similarity
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MARILITGSTDGFGLEAARQLVDRKHVVYLHARSQERAEEVKTKCPGAAGVLVADLTSVAETRKLAEEANAIGTFDAIILNAGLLYGPFRKTDYGVPAMPFVNVLAPYILSCLLEQPKRLIFIASILHKEAKTDLKDIFWLERGEKEFQDFPAYCDSKFHVMLLANAVAKRFKGTSVTSVHPGYVATKLGGSGATDKMEDGVETYVMLAEGDYDQSLTGVYFVPKKQIGEPLPETTQEDLQETVVKACEDITGIKLPA