chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

300 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.843 kDa

MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYQGYGEVDSVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIVASVREKSKTHPLRLAGLIGNRTSKRDLIDKYVEVCPMPVIEVLPLIEDIRVSRVKGKTVFEMAETDQKLNYICDFYLNIADQLLASPEGVIPLELEDRELFTLLSTFYLTVTPQNQGETQSTISTPLTSNSASELDFILV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

300 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.843 kDa

MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYQGYGEVDSVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIVASVREKSKTHPLRLAGLIGNRTSKRDLIDKYVEVCPMPVIEVLPLIEDIRVSRVKGKTVFEMAETDQKLNYICDFYLNIADQLLASPEGVIPLELEDRELFTLLSTFYLTVTPQNQGETQSTISTPLTSNSASELDFILV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

300 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.843 kDa

MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYQGYGEVDSVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIVASVREKSKTHPLRLAGLIGNRTSKRDLIDKYVEVCPMPVIEVLPLIEDIRVSRVKGKTVFEMAETDQKLNYICDFYLNIADQLLASPEGVIPLELEDRELFTLLSTFYLTVTPQNQGETQSTISTPLTSNSASELDFILV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

300 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.843 kDa

MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYQGYGEVDSVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIVASVREKSKTHPLRLAGLIGNRTSKRDLIDKYVEVCPMPVIEVLPLIEDIRVSRVKGKTVFEMAETDQKLNYICDFYLNIADQLLASPEGVIPLELEDRELFTLLSTFYLTVTPQNQGETQSTISTPLTSNSASELDFILV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

300 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.898 kDa

MTTTLTPPSSRREDGDGSVQVHQDASLKIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELQPEDFVFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKNYKVRLGGVVANRSAETDQIDKFNERTGLRTMAHFRDVDAIRRSRLKKCTIFEMDKDEEGVEAVQNEYLLLAQNMLDHVEPLEAESLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.402 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRISRVKGKTLFEMAESEPSLDYVCEFYLNIADQLLARPEGVVPKEVPDRELFSLLSDFYLNPANNASSIEQPTDSIVQSEQEPFLII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.402 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRISRVKGKTLFEMAESEPSLDYVCEFYLNIADQLLARPEGVVPKEVPDRELFSLLSDFYLNPANNASSIEQPTDSIVQSEQEPFLII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.467 kDa

MTTILTRPADGEGSVQVHQDPALNIQEETLVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFVFTGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKNYKVRLGGVVANRSADTDQIDKFNERTGLRTMAHFRDVDAIRRSRLKKCTIFEMDDADEAVQAVQNEYLRLAQNMLDKVEPLEATSLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.395 kDa

MTTTLANRPDGEGSVQVKLDPKVNIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPQDFMFEGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVDAIRRSRLKKCTIFEMDPEEEGVLEVQNEYLSLAKKMIDNVEPLEAEPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.341 kDa

MTTTLTRPADGEGSVQVQQDASVRIQEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHRMVPTVIDILEEVDFHSEELRPDDFMFEGFNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNQQTGLKTMAHFKNVDAIRRSRLKKCTIFEMDSSDEGVMECQNEYLSLAQKMLDNVEPLEAEPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.464 kDa

MTSTITRKEDGEGSVQVKQDPKAQIQEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMFKGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNERTGLKTMAHFRNVDAIRRSRLKKCTIFEMDSEEEGVVEVQNEYLSLAQKMIDNVEPLEAEPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.546 kDa

MTTTLKRPTDGEGSVQVHQDPSVNIEEETLVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFVFSGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKNYKVRLGGVVANRSADTDQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDDDEAVQAVREEYLRLAQNMLDNVEPLEATSLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.502 kDa

MTTTLTRPTDGEGSVQVHQDPGLNIQEETLVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFVFTGFNGVQCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKNYKVRLGGVVANRSADTDQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDEDEAVQAVRSEYLRLAQNMLDKVEPLEATSLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.334 kDa

MTTTLTRPADGDGSVQVHQDPGTKIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMFTGYNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKNYKVRLGGVVANRSAETDQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDKDDGVKAVQDEYIRLASNMLNNVEPLEAVSLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

296 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.37 kDa

MTTTLSRPTDGEGSVQVQQDPSMKIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTHSMVPTVIDILEEVDFHSEELRPDDFVFTGYNGVKCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVQAIQAKAKNYKVRLGGVIANRSADTDQIDKFNERTGLRTMAHFKDVDAIRRSRLKKCTIFEMDDDDDAVKAVKNEYLRLAQNMLDNVEPLEAVSLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

295 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.319 kDa

MTSTINKHLDGEGSVQVKQDPKVNIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKNYKVRLGGVVANRSKDTDQIDKFNDRTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTEDVIEVQNEYLSLAKNMLENVEPLEGTPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

295 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.32 kDa

MTSTINKPLDGEGSVQVKQDPKINIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKNYKVRLGGVVANRSKDTDQIDKFNERTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTEDVIEVQNEYLSLAKNMLENVEPLEGNPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

295 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.25 kDa

MTSTINKPLDGEGSVQVKQDPKVNIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVSAIQAKAKNYKVRLGGVVANRSKDTDQIDKFNNRTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTEDVVEVQNEYLSLAKNMLDNVEPLEGTPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

295 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.348 kDa

MTSTINRPLDGEGSVQVKQDPKINIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKVLQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPTDFMFEGFNGVMCVESGGPPAGTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVSAIKAKAKNYKVRLGGVVANRSKDTDQIDKFNERTGLKTMAHFKDVDAIRRSRLKKCTIFEMEPTEDVIEVQNEYLSLAKNMLENVEPLEGNPLKDREIFDLLGFD

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

293 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.23 kDa

MKVAVYGKGGIGKSTTSCNISIALARRGRKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQVKDYHYEDVWPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKSHTHPLRLAGLVGNRTSGRDLIDKYVEACPMPVLEVLPLVEDIRVSRVKGKTLFEMAEYQPNLNYVCDFYLNIADQILSEPEGVVPREIPDRELFSLLSDFYLNSTFTNESDGGYDHQDVPLDFTII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

293 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.945 kDa

MKLAVYGKGGIGKSTTSCNISIALRKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLSSKDYHYEDIWPEDVIYGGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFFEYDVILFDVLGDVVCGGFAAPLNYADYCIIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYVEACPMPVLEVLPLIEEIRISRVKGKTLFEMSNKNNMTSAHMDGSKGDNSTVGVSETPSEDYICNFYLNIADQLLTEPEGVIPRELADKELFTLLSDFYLKI

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

293 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.23 kDa

MKVAVYGKGGIGKSTTSCNISIALARRGRKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQVKDYHYEDVWPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKSHTHPLRLAGLVGNRTSGRDLIDKYVEACPMPVLEVLPLVEDIRVSRVKGKTLFEMAEYQPNLNYVCDFYLNIADQILSEPEGVVPREIPDRELFSLLSDFYLNSTFTNESDGGYDHQDVPLDFTII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

293 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.945 kDa

MKLAVYGKGGIGKSTTSCNISIALRKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLSSKDYHYEDIWPEDVIYGGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFFEYDVILFDVLGDVVCGGFAAPLNYADYCIIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYVEACPMPVLEVLPLIEEIRISRVKGKTLFEMSNKNNMTSAHMDGSKGDNSTVGVSETPSEDYICNFYLNIADQLLTEPEGVIPRELADKELFTLLSDFYLKI

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

292 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.314 kDa

MKLAIYGKGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQIKDYHYEDVWPEDVIHKGYGGVDRVEAGGPPAGAGCGGYVVGETVKLSKELNAFYEYDIILFDVLGDAVRGGFASPLNYADYCIIIADNGFDALLATNRIAASVREKARTRTHPLRLAGLVGNRTSERDLIDKYVEVCPMPILEILPLIEDIRVSRIKGKTLFEMVESQPYLNYVCDFYLNTADQILSKPEGIIPKEISDRELFSLLSDFYLNPVGNEEQENKENLLDSVVLI

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

292 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.314 kDa

MKLAIYGKGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQIKDYHYEDVWPEDVIHKGYGGVDRVEAGGPPAGAGCGGYVVGETVKLSKELNAFYEYDIILFDVLGDAVRGGFASPLNYADYCIIIADNGFDALLATNRIAASVREKARTRTHPLRLAGLVGNRTSERDLIDKYVEVCPMPILEILPLIEDIRVSRIKGKTLFEMVESQPYLNYVCDFYLNTADQILSKPEGIIPKEISDRELFSLLSDFYLNPVGNEEQENKENLLDSVVLI

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

291 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.809 kDa

MKIAVYGKGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDIWPEDVIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCVIITDNGFDALFAANRITASIREKARTHPLRLAGLVGNRTSKRDLIHKYVEACPMPVIEVLPIIEDIRVSRVKGKTLFEMVGSEPSLNYVCKYYLDIADQILSQPEGIVPKEIPDRELFSLLSDLYLNPIGGGGQKKKNQENLLGFTRI

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

291 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.809 kDa

MKIAVYGKGGIGKSTTSCNISVALARRGQKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDIWPEDVIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCVIITDNGFDALFAANRITASIREKARTHPLRLAGLVGNRTSKRDLIHKYVEACPMPVIEVLPIIEDIRVSRVKGKTLFEMVGSEPSLNYVCKYYLDIADQILSQPEGIVPKEIPDRELFSLLSDLYLNPIGGGGQKKKNQENLLGFTRI

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.856 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKSLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKAHTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESQPTLNYVCEFYLNIADQILSQPEGVVPKEIPDRELFSLLSDFYLNPINSGKNENIENNLHDFMII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.064 kDa

MKIAVYGKGGIGKSTTSCNTSIASARRGKRVLQIGCDPKHDSTFTLTGSLIPTIIDTSQSKDYHYEDVWPEDVIYKGYGGVDCVEVGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVSGDVVCGGFVVLLNYADYCIIITDNGFDALFAVNCIAASVREKARTHSLRLAGSVGNRTSKRDLINRYVEACPMPVLEVSLLIEDIRVSRVKGKTSFEMVEFQPFLNYVCEFYLNIADQILSQPEGVIPKEIPDRELFSLLSDFYLNPTNNERENKNQETLLDFMII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.553 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGGKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEEIWPEDVIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGLAAPLNYADYCVIITDNGFDALFAANRIAVSIGEKTRTHLLRLAGLVGNRTSKRDLIDGYVEVCPMPVIEVLPLIEDIRISRVKGKTLFEMVGSEPSLNYVCEYYLNIADQILSQPEGIVPKEIPDRKFFSLLSDSYLSPINDGKQGKNQENLLGFTMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.856 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKSLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKAHTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESQPTLNYVCEFYLNIADQILSQPEGVVPKEIPDRELFSLLSDFYLNPINSGKNENIENNLHDFMII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

32.064 kDa

MKIAVYGKGGIGKSTTSCNTSIASARRGKRVLQIGCDPKHDSTFTLTGSLIPTIIDTSQSKDYHYEDVWPEDVIYKGYGGVDCVEVGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVSGDVVCGGFVVLLNYADYCIIITDNGFDALFAVNCIAASVREKARTHSLRLAGSVGNRTSKRDLINRYVEACPMPVLEVSLLIEDIRVSRVKGKTSFEMVEFQPFLNYVCEFYLNIADQILSQPEGVIPKEIPDRELFSLLSDFYLNPTNNERENKNQETLLDFMII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.553 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGGKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEEIWPEDVIHKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGLAAPLNYADYCVIITDNGFDALFAANRIAVSIGEKTRTHLLRLAGLVGNRTSKRDLIDGYVEVCPMPVIEVLPLIEDIRISRVKGKTLFEMVGSEPSLNYVCEYYLNIADQILSQPEGIVPKEIPDRKFFSLLSDSYLSPINDGKQGKNQENLLGFTMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.832 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESEPSLNYVCEFYLNIADQILSQPEGVVPKEVPDRELFSLLSDFYLNPSSSRSDMQLEDNSLDFVMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

290 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.879 kDa

MKLAVYGKGGIGKSTTSCNISVALSKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGFAAPLNYADYCLIITDNGFDALFAANRIAASVREKARTHSLRLAGLVGNRTDKRDLIDKYIDCVPMPVLEVLPLIEDIRVSRVKGKTLFEMAEIDKDLAYVCDYYLNIADQLITRPEGVVPKESPDRELFSLLSDFYLNPKSKVGQEKVDQEELDLMIV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

289 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.661 kDa

MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYIEAVPMPVLEILPLIEDIRVSRVKGKTLFEMTESDPSLDYVCNYYLNIADQLLAMPEGVVPNDAPDRELFTLLSDFYLNPQTPVKSQEEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

289 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.661 kDa

MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYIEAVPMPVLEILPLIEDIRVSRVKGKTLFEMTESDPSLDYVCNYYLNIADQLLAMPEGVVPNDAPDRELFTLLSDFYLNPQTPVKSQEEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

289 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.812 kDa

MKLAVYGKGGIGKSTTSCNISIALAKRGKKVLQIGCDPKSDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYQGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKEFNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIVTDNGFDALFAANRITASVREKARTHPLRLAGLIGNRTKKRDLIEKYVETCPMPILEVLPLIEDIRVSRVKGKTLFEMTESEPTLQFVCDFYLNIADQLLTQPEGVIPRELGDRELFNLLSNFYLNSSNSTNTTLKNETNLFDLV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

289 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.678 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKRVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAESDPSQNYVCDFYLNIADQILSKSEGVVPREVPDRELFSLLSDFYLNQPSSSTNNSETNNLDFLMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.449 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIEKYVEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLSIADQILARPEGVVPNDAPDRELFSLLSDFYLNPGKPQVPNPEEELDLMIV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.729 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGEVNCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAETDSSLEYVCDYYLNIADQILSQPEGIVPKEIPDRELFTLLSDFYLNININSNNLEKNESSFLII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.449 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIEKYVEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLSIADQILARPEGVVPNDAPDRELFSLLSDFYLNPGKPQVPNPEEELDLMIV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.729 kDa

MKIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGEVNCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKRDLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFEMAETDSSLEYVCDYYLNIADQILSQPEGIVPKEIPDRELFTLLSDFYLNININSNNLEKNESSFLII

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.48 kDa

MTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAAKRIAASVREKARTHSLRLAGLIGNRTSKRDLIDKYIEAVPMPVLEILPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIADQILSQPEGVVPKDAQDRDLFSLLSDFYLNPTQPASQTKELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.54 kDa

MKLSVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDIWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYSDYCMIVTDNGFDALFAANRIAASVREKARTHTLRLAGLIGNRTSKRDLINKYVEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAETDPSLQYVCNYYLNIADQILALPEGVVPSESPDRDLFALLSDFYLNPSKSHVMSEDEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.706 kDa

MKLAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYENVWPEDVIYQGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDIILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHPLRLAGLVANRTTKRDLIDKYVQVCPIPVLEVLPLLEDIRVSRVKGKTLFEMAESEPDLSFVLDYYLNIADQLLTEPEGVVPRELGDRELFSLLSDFYLNIENQTSVNKTEKLDFFLV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

288 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.437 kDa

MTMTLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDFHYEDIWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIEKYVSHVPMPVLEVLPLIEDIRVSRVKGKTLFEMAEGDSMLDYVCDFYLNIADQVLAAPEGVVPSEASDRELFSLLSDYYLNPPVEKTQEDELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.258 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPEDVIYKGFGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYIDSVPMPVLEILPLIEDIRVSRVKGKTMFEMAESDPSLEPVCNYYLNIADQILAGPEGVVPEDAQDRELFALLSDFYLNPTQPKTEEEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.193 kDa

MKLAVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYENVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHVLRLAGLIGNRTAKRDLIDKYVEAVPMPVLEILPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIADQILARPEGVVPQGAPDRDLFALLSDFYLNPAPNKVEQEDLELMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.22 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWAEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTAKRDLIEKYVDAVPMPILEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIADQILANPEGVVPKDAADRDLFSLLSDFYLNPQQPKTAEEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.258 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWPEDVIYKGFGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYIDSVPMPVLEILPLIEDIRVSRVKGKTMFEMAESDPSLEPVCNYYLNIADQILAGPEGVVPEDAQDRELFALLSDFYLNPTQPKTEEEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.193 kDa

MKLAVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYENVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHVLRLAGLIGNRTAKRDLIDKYVEAVPMPVLEILPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIADQILARPEGVVPQGAPDRDLFALLSDFYLNPAPNKVEQEDLELMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.22 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQEKDYHYEDVWAEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTAKRDLIEKYVDAVPMPILEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIADQILANPEGVVPKDAADRDLFSLLSDFYLNPQQPKTAEEELDLMMV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.118 kDa

MKLSVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYSDYCLIITDNGFDALFAANRIAASVREKARTHTLRLAGLIGNRTSKRDLIDKYIEAVPMPVLEVLPLIEDIRISRVKGKTVFEMAETEPSLLTVCDYYLNIADQILARPEGVVPKDAADRDLFSLLSDFYLNPPKQTTEAIAPEALLV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

286 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

31.118 kDa

MKLSVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYSDYCLIITDNGFDALFAANRIAASVREKARTHTLRLAGLIGNRTSKRDLIDKYIEAVPMPVLEVLPLIEDIRISRVKGKTVFEMAETEPSLLTVCDYYLNIADQILARPEGVVPKDAADRDLFSLLSDFYLNPPKQTTEAIAPEALLV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

283 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

30.806 kDa

MEERAVKLAVYGKGGIGKSTTSCNLSVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLEAKGYHYEDIYPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCVIVTDNGFDALFAANRIAASVREKAKTRKLRLAGLIGNRTSKRDLIDQYVSAVPMPVLEVLPLVEDIRISRVKGKTLFEMAETDPSLEPVCQYYLNIADELLARPEGIVPRPAEDRELFALLSDFYKTPVREPALV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

283 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

30.767 kDa

MEERAVKLAVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLEAKGYHHEDIYPEDVIYRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKAKTRKLRLAGLIGNRTSKRDLIDKYVSAVPMPVIEVLPLIEDIRVSRVKGKTLFEMAETDPSLEPVCQYYLNIADELLARPEGIVPQPAEDRELFALLSDFYNTPARQLALV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

282 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

30.847 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGHLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGFASPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHQLRLAGLIGNRTTKSDLIEKYTENVPIPILQLLPLIEDIRISRVKGKTLFEMSESNPELSPICDYYLNIADQILAKPEGIIPNEVLDRDLFTLLSDFYLNMDSSESSNLTLV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

282 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

30.847 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGHLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDIILFDVLGDVVCGGFASPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHQLRLAGLIGNRTTKSDLIEKYTENVPIPILQLLPLIEDIRISRVKGKTLFEMSESNPELSPICDYYLNIADQILAKPEGIIPNEVLDRDLFTLLSDFYLNMDSSESSNLTLV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

281 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

30.542 kDa

MKLAVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGNRTNKRDLIEKYVEAVPMPILEVLPLIEDIRVSRVKGKTLFEMAESDPSLNDVCDYYLNIADQILARPEGVVPKDVPDRDLFALLSDFYLNPQGSERSLAAV

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

275 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

29.996 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGRRVLQIGCDPKHDSTFTLTGFLIPTIIDTLEEKDYHYEDVYAEDVIYEGYGGVHCVEAGGPPAGAGCGGYVVGETMKLLKELRAFEDHDVILFDVLGDVVCGGFAAPLNYADYCVIITDNGFDALFAANRIAASCREKARTHPLKLAGLVGNRTNKRDLIDKYVEAVPMPVLEILPLIEDIRVSRVKGKTIFEMAETDPSLEPVCQYYLNIADHLLACPEGVVPQECPDRALFELLSDFYSRTPVPA

chlL

Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

275 amino acids

Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The L component serves as a unique electron donor to the NB-component of the complex, and binds Mg-ATP.

Belongs to the NifH/BchL/ChlL family.

29.996 kDa

MKLAVYGKGGIGKSTTSCNISVALAKRGRRVLQIGCDPKHDSTFTLTGFLIPTIIDTLEEKDYHYEDVYAEDVIYEGYGGVHCVEAGGPPAGAGCGGYVVGETMKLLKELRAFEDHDVILFDVLGDVVCGGFAAPLNYADYCVIITDNGFDALFAANRIAASCREKARTHPLKLAGLVGNRTNKRDLIDKYVEAVPMPVLEILPLIEDIRVSRVKGKTIFEMAETDPSLEPVCQYYLNIADHLLACPEGVVPQECPDRALFELLSDFYSRTPVPA