cheB5

Protein-glutamate methylesterase/protein-glutamine glutaminase 5

362 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.097 kDa

MPHGPGTSARPVRVLVVDDSALVRETLAAVLASDPGIEVIGAAGDPYAAVERMRRQAPDVITLDIEMPRMDGLTFLRKLMAQHPIPVVICSSLATAGAEPALRALECGAVEVVAKPRLGTRRFLEESRVRLCDAVKAAARAGPGRPRASAPLVQAKLTADAVLARPRSDAVLQTTERVVVVGASTGGTEALRELLAALPGDAPGLVIVQHMPEVFTAAFARRLDGLCAVAVKEAADGDAVVPGRALIAPGNRHTLLRRSGARYHVEVRDGPLVCRHRPSVDVLFRSAARYAGRNAVGVIMTGMGDDGARGLAELKRSGADTIAQDEATSVVFGMPREAIRLGAADRVLPLPAIPPELLRLCR

cheB5

Protein-glutamate methylesterase/protein-glutamine glutaminase 5

357 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.875 kDa

MLPNQERKLRVLVVDDSSFMRMVIRSVLEKDPAIEVIAVAMDGVEGVEKALALRPDLITMDIEMPRLDGISALKEIMAKAPTRVLMVSTLTCEGAKATFDALDAGAIDYIPKNVTDSIDAQKAFKEELLRKVKGSGISILGRPLVSPSPRLVVPPRPVIIPRPAGQRYQYVGIGASTGGPVAVQEVLGRIPGNFPHGIVVAIHMPKAFTGPYAERLNTKCSLQVKEAKAGDIVQPGVVLVTPGGMHTALVRQGSTVAIRTIATAEYPQYIYIPSVDHMLTTFADACNGSLLGVILTGMGADGFKGMKHLKTKGGGTIVQDEATSTIYGMPRACIEGGVADTVLPLTQIGTEITKIAG

cheB5

Protein-glutamate methylesterase/protein-glutamine glutaminase 5

348 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

35.939 kDa

MTVVSPIRVLVVDDSAFARKVLRQVLSSAEGLEVVGVARDGLDALEKVAELSPDVLTLDLVMPGLDGLGVLRALASSAAAPRVVVVSSAGEESELAVAALQAGAVELVNKPTALATERLYELGGELVAKVRTAAGAVARAPPEPAPSPEATSAPVARAAAKSLVVVGTSTGGPQALTRLLSELPVDFPAPLALALHIPTGYTEAVARRLNAHCALEVFEAVDGLELRPGRVVLARSGQHLKLERHGPVTLARLDRQPLRTAHHPSVDVLFESAARSWGSDVVGLVLTGMGDDGVAGARAIREAGGTVLTESESSCVVYGMPRAVKEAGLATDSAPLEGMLALLRRHVR