Function
Catalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), an important precursor for the synthesis of phosphatidylinositol (PtdIns) and phosphatidylglycerol (PG) (PubMed:7816135, PubMed:24603715). Required for the regeneration of the signaling molecule phosphatidylinositol 4,5-bisphosphate (PtdInsP2) from PA and maintenance of its steady supply during signaling thus playing an essential role during phospholipase C-mediated transduction (PubMed:7816135). In the salivary glands and possibly other adipose tissues, function is essential for regulating cell growth and neutral lipid storage by coordinating PtdIns metabolism and insulin pathway activity (PubMed:24603715). Acts by positively regulating activity of the insulin pathway through synthesis of PtdIns, and in turn the insulin pathway up-regulates the synthesis of CdsA (PubMed:24603715). This CdsA-insulin positive feedback loop may be one of the mechanisms for coordinating cell growth and fat storage; switching to fat storage when cells reach homeostasis or converting from growth to fat storage under nutrient-poor conditions (PubMed:24603715).
Sequence
MAEVRRRKGEDEPLEDTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELAKNLPQGTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVTYHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSLKLFGIGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLLTQIYNLKPDQQYQIYQSLKDNLGDMLT