ccmA2

Cytochrome c biogenesis ATP-binding export protein CcmA 2

211 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.533 kDa

MADAVLEARELGVRRGHCAIFRGLGISLAPGDLLQVMGPNGAGKTSLLRVLSSLMPPAEGDLYWRGRAVRAGDPDYLAQVAYLGHVNGIYPDLSAFENLQFAARMAGQQPDADAMHHALARFGLDRVADAPARTLSQGQRRRVALSRLALTPRALWLLDEPLTSLDDASTDCFHTLLAEHLQRGGIAVVATHQRLPAEGAVLDLATDAGSP

ccmA2

Cytochrome c biogenesis ATP-binding export protein CcmA 2

205 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.327 kDa

MLEARDLHCERDERTLFSGLSFTVDAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEALAQAGLAGFEDVPVARLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGEAGL

ccmA2

Cytochrome c biogenesis ATP-binding export protein CcmA 2

205 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.336 kDa

MLEARDLYCERDERTLFRGLSFTVEAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEALAQAGLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGGAGL