ccmA1

Cytochrome c biogenesis ATP-binding export protein CcmA 1

207 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

23.024 kDa

MTRPMLEALDLAGVRGERRLFDHLTFRIVPGECLSVHGENGSGKTTLLRTLAGFATPAAGRVLWKGKPLRNQWSEYQRELVYNGHGIGLKEDLNALDNLLAAAAIAGEPVTTECVESALDEVGLAEHRHLPFRMLSQGQKRRASLARLLLYRRKLWILDEPSTALDQFGARWLGELIHRHQSRGGMVVLTSHQELALKTSQTVRMGA

ccmA1

Cytochrome c biogenesis ATP-binding export protein CcmA

205 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.336 kDa

MLEARDLYCERDERTLFRGLSFTVEAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEALAQAGLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGGAGL

ccmA1

Cytochrome c biogenesis ATP-binding export protein CcmA 1

205 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.35 kDa

MLEARDLYCERDERTLFRGLSFTVDAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEALAQAGLAGFEDVPVARLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGGAGL

ccmA1

Cytochrome c biogenesis ATP-binding export protein CcmA 1

205 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.422 kDa

MLEARDLYCERDERTLFRGLSFTVDAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEALAQAGLAGFEDVPVARLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGEAGL

ccmA1

Cytochrome c biogenesis ATP-binding export protein CcmA 1

205 amino acids

Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.

Belongs to the ABC transporter superfamily. CcmA exporter (TC 3.A.1.107) family.

22.322 kDa

MLEARDLYCERDERTLFRGLSFTVDAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEALAQAGLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQGGMVILTTHQPLPGAADTVRRLALTGGGAGL