CBC2

Nuclear cap-binding protein subunit 2

218 amino acids

Component of the cap-binding complex (CBC) involved in the nuclear export of capped U snRNAs. The CBC complex is required for efficient pre-mRNA splicing through efficient commitment complex and spliceosome formation; and involved in rRNA processing at sites A0, A1 and A2 (By similarity).

Belongs to the RRM NCBP2 family.

24.967 kDa

MSLAEFDELRWDHSCDRLDVPSNYLKRKARKTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAALKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDELRFEFDASRGGFYVPLENRIGAVNHFGARRIRDPHKNHHHHHHGHHHHHGQPHAAAAKVNPMEVEEELDSYIPGQ

CBC2

Nuclear cap-binding protein subunit 2

208 amino acids

Component of the CBC complex, which binds co-transcriptionally to the cap of pre-mRNAs and is involved in maturation, export and degradation of nuclear mRNAs. The CBC complex is required for efficient pre-mRNA splicing through efficient commitment complex and spliceosome formation. Together with NPL3, the CBC complex is required for export of mRNAs out of the nucleus. The CBC complex is also involved in nuclear mRNA degradation, probably by directing the mRNAs to the sites of degradation. Affects replication of the positive-strand RNA virus BMV.

Belongs to the RRM NCBP2 family.

23.774 kDa

MSLEEFDEVKYDHSTKRLDTPSRYLLRKARRNPNGLQELRESMKSSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTKLDEKTITIDLDPGFEDGRQFGRGKSGGQVSDELRFDFDASRGGFAIPFAERVGVPHSRFDNSSSQSNTNNYIPPPDAMGTFRPGFDEEREDDNYVPQ

cbc2

Nuclear cap-binding protein subunit 2

182 amino acids

Component of the CBC complex, which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in maturation, export and degradation of nuclear mRNAs.

Belongs to the RRM NCBP2 family.

20.798 kDa

MASITRLDAVSPYLIRRFKNDLRALDAVKQSNCVYVGNLSFYTTEEQIYALFSKCGEIRRIIMGVDRFTKTPCGFCFVEYFENQDALDSLKYISRTSLDERIIRADLDHGYEEGRQYGRGASGGQVRDEMREEFDPGRGGYAKNRQPTSSRQLANYSGISSAPLGSSLELQSNPRYNRWKKN