cbbS2

Ribulose bisphosphate carboxylase small chain 2

118 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

13.627 kDa

MSEVQDYKSRLSDPASAKFETLSYLPALTADEIRQQVAYIVSKGWNPAVEHTEPENAFGNYWYMWKLPMFGETDVDTILKEAERCHKRNPHNHVRIVGYDNFKQSQGTSLVVYRGKTV

cbbS2

Ribulose bisphosphate carboxylase small chain 2

113 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

13.393 kDa

MNTASSMGDHATIGRYETFSYLPPLNREEILEQILYILDNGWNASLEHEHPDRAFEYYWPMWKMPFFGEQDPNVILTEIESCRRSYPDHHVRLVGYDTYAQSKGHSFLVHRAR