cbbS

Ribulose bisphosphate carboxylase small chain

134 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

15.515 kDa

MKLTQGCFSFLPDLTDDQIYKQVQYCLAKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLQDAAGVMMELAECRRVYGDRYIRISGFDSSPGWESVRISFLVNRPPQEAEFELVRQEVGGRAIRYTTVRKAPAHVS

cbbS

Ribulose bisphosphate carboxylase small chain

133 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

15.318 kDa

MRITQGTFSFLPDLTAAQVKAQIQYALDQNWAVSVEYTDDPHPRNTYWEMWGLPMFDLRDAAGVYGEVEACRTAHPGKYVRVNAFDSNRGWETVRLSFIVQRPEKEDGFRLDRTEGPGRTQRYALQHRSYAAG

cbbS

Ribulose bisphosphate carboxylase small chain

129 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.147 kDa

MRITQGCFSFLPDLTDEQITAQVQYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKDAKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRSQHYMWETQR

cbbS

Ribulose bisphosphate carboxylase small chain

129 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

15.161 kDa

MRITQGCFSFLPDLTDEQITAQVEYCLGRGWAIGVEYTDDPHPRNTYWEMWGNPMFDLRDAKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESDGRSQHYTWETQR

cbbS

Ribulose bisphosphate carboxylase small chain 1

129 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

15.164 kDa

MRITQGCFSFLPDLTDEQISAQVDYCLGRGWAVSLEHTDDPHPRNTYWEMWGMPMFDLRDPKGVMIELDECRKAWPGRYIRINAFDSTRGFETVTMSFIVNRPEVEPSLRMERTEVDGRSIRYTHSIVR

cbbS

Ribulose bisphosphate carboxylase small chain

124 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

14.656 kDa

MSETQDMIRDVQDYPSRLNDPKSKRFETFSYLPQMSAEEIRKQIEYIVSKGWNPAIEHCEPENAILHYWYMWKLPMFGETDVDKIIAEIEACKRSNPNHLIKLIGYDNIRQTQGTAMLVYRPAQ

cbbS

Ribulose bisphosphate carboxylase small chain

121 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

13.857 kDa

MSEIQDYNSSVSDPSSRKFETFSYLPELGVEKIRKQVEYIVSKGWNPAVEHTEPENAFDHYWYMWKLPMFGETDVDAILAEAEACHKAHPSHHVRLIGYDNYAQSQGTAMVIFRGPISAKC

cbbS

Ribulose bisphosphate carboxylase small chain

118 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

13.608 kDa

MSEVMDYKSRLSDPASRKFETFSYLPAMNAADIRKQVEYLVSKGWNPAIEHTEPEHLMDSYWYMWKLPMFGETDIDRILGEAEACHKANPNNHVRLVGYDNFAQSQGAAMVIYRGKTV

cbbS

Ribulose bisphosphate carboxylase small chain

118 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

13.548 kDa

MSTVQDYPSRLSRPESRKMGTFSYLPPMGEAEIRRQVEWIVKNGWNPGIEHTEPDFAAQIYWYMWKLPMFGETDVDAILAELKACHEANPGHHVRLIGYDNFTQSQGANMIVYRGTAV

cbbS

Ribulose bisphosphate carboxylase small chain

113 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

12.943 kDa

MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSNSMATYWSYWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFEGR

cbbS

Ribulose bisphosphate carboxylase small chain

113 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

13.239 kDa

MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPFFGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY

cbbS

Ribulose bisphosphate carboxylase small chain

113 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

12.943 kDa

MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSNSMATYWSYWKLPFFGEKDLNVVVSELEACHRAYPDHHVRIVGYDAYTQSQGACFVVFEGR

cbbS

Ribulose bisphosphate carboxylase small chain

111 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

13.212 kDa

MKTLPKEKRYETLSYLPPLSDQQIARQVQYMMDQGYIPGIEFEKDPTPELHHWTLWKLPLFNASSAQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNQTRY

cbbS

Ribulose bisphosphate carboxylase small chain

111 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

13.333 kDa

MSMKTLPKERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKLPLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRPGRY

cbbS

Ribulose bisphosphate carboxylase small chain

110 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.

Belongs to the RuBisCO small chain family.

12.855 kDa

MAEMQDYKQSLKYETFSYLPPMNAERIRAQIKYAIAQGWSPGIEHVEVKNSMNQYWYMWKLPFFGEQNVDNVLAEIEACRSAYPTHQVKLVAYDNYAQSLGLAFVVYRGN

cbbS

Ribulose bisphosphate carboxylase small chain

109 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

12.963 kDa

MKTLPKERRYETLSYLPPLSDQQIARQIEYMVREGYIPAVEFNEDSDATTCYWTMWKLPLFHATSTQEVLGEVRECRTEYPNCYIRVVGFDNIKQCQSVSFIVHKPNRY

cbbS

Ribulose bisphosphate carboxylase small chain

109 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

12.827 kDa

MQTLPKERRYETLSYLPPLTDVQIEKQVQYILSQGYIPAVEFNEVSEPTELYWTLWKLPLFGAKTSREVLAEVQSCRSQYPGHYIRVVGFDNIKQCQILSFIVHKPSRY

cbbS

Ribulose bisphosphate carboxylase small chain

108 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

12.555 kDa

MAVQAYRSLKKYETFSYLPQMTPEQVRRQIAHAIAQGWNPAVEHTEKGTPAKASYWYMWKLPLFGEQSVDAVVAEIEACHREFPDQMVRFVAYDNYAQSQGMAFVVYR

cbbS

Ribulose bisphosphate carboxylase small chain

10 amino acids

RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity).

Belongs to the RuBisCO small chain family.

1.322 kDa

single

MQTLPKERRY