cas4

CRISPR-associated exonuclease Cas4

333 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). This may be a 5' to 3' ssDNA exonuclease (By similarity).

Belongs to the CRISPR-associated exonuclease Cas4 family.

35.537 kDa

MAPSDTPPSAEDLPSQGELALFAPPATAEDALVPASMVNAWIYCPRLAVLEWGRGEKARSVDLIAGLRAHQATESGPTPALPDPMVLREDQSLKTRKLSLSSERLGLTAELDLLDVEEGVVIPVEIKVGKRPSVDEGAYLPERAQVCAQALLLREAGYTCLEGALWFAESRERVTVDLTEALVTATLVATSDLRLTVASGRLPPPLDHSAKCPRCSLLPICLPDEIAWFRKGSIARTPPPPASPALPLYGQTPGARIGKKDRGGSVCLDRMAAWLSSRPVPCYAAIGMLNTASGASHPSVARHADGGASARSFRLPTAFRRPVRRSLPCYAAR

cas4

CRISPR-associated exonuclease Cas4

213 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). A ssDNA exonuclease that has 5' to 3' activity, yielding 5'-OH and 3'-phosphate groups. Has Mn(2+)-dependent endonuclease activity on circular ssDNA. Can unwind dsDNA; unwinding does not require ATP.

Belongs to the CRISPR-associated exonuclease Cas4 family.

24.673 kDa

MELLSPKPLCSVVNCEDLEKLDHVSALNELRREQEIFKLLPGIYAHRYDFRRVSPSIINDFEYCPRLLWVQHKLGLKLLSEKSVVSIIRGRILHERYERLLSQYENVVAEYKVEIGDLVGVVDLVIKRGGEYIPVEIKTGFSKEAHKTQLQIYISMLKARFGYLVYRNHVEVVHRNDAALDVLKKIREILSAREAPPAKCNSCIFKPICKNLL

cas4

CRISPR-associated exonuclease Cas4

202 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA) (By similarity). This protein is a 5' to 3' partially processive exonuclease that cleaves off single mononucleotides. Has a marked preference for ssDNA, although in vitro it also acts on dsDNA and ssRNA. Has low endonuclease activity with circular ssDNA. Binds ssDNA and can unwind dsDNA; unwinding does not require ATP.

Belongs to the CRISPR-associated exonuclease Cas4 family.

23.239 kDa

MITEFLLKKKLEEHLSHVKEENTIYVTDLVRCPRRVRYESEYKELAISQVYAPSAILGDILHLGLESVLKGNFNAETEVETLREINVGGKVYKIKGRADAIIRNDNGKSIVIEIKTSRSDKGLPLIHHKMQLQIYLWLFSAEKGILVYITPDRIAEYEINEPLDEATIVRLAEDTIMLQNSPRFNWECKYCIFSVICPAKLT

cas4

CRISPR-associated exonuclease Cas4

199 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). This may be a 5' to 3' ssDNA exonuclease (By similarity).

Belongs to the CRISPR-associated exonuclease Cas4 family.

22.699 kDa

MRPVSMLKEYAYCPRVAYYMEVLRPSYRPTEPMNLSREIYSVDHVRGILRSSGFRIVKEEWAVPLRSKRLGLQGVADGVVVEGSLGIIVVEAKLSVRSNRWLHTRGRHVIFQAAAYALALEETRGYSVDYLAIVSLEDSKTYVVKMSPSLRRDVIRLADDMNKTLDDGLEPPPKPGRKCVACRFRRVCQPWVAERGSER

cas4

CRISPR-associated exonuclease Cas4

196 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). This may be a 5' to 3' ssDNA exonuclease (By similarity).

Belongs to the CRISPR-associated exonuclease Cas4 family.

22.909 kDa

MNMDIFDNDLSIPVNLIRQWCFCPRIVYYQELLAIKPNKPLWVAQGEEFHKKVEQLEKRRSFSRYGLENAIRHFNLSIKSQKYKLHGIVDWVIETDTNVYVVEYKTNPNPNSLGHKLQIAAYALLVQEYFAKPCKTTFLTSDKKSYEIKITDELINKLIKTISDILSTLDSGNKPDSSASDHQCIQCEYYNFCNDR

cas4

CRISPR-associated exonuclease Cas4

190 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). This may be a 5' to 3' ssDNA exonuclease (By similarity).

Belongs to the CRISPR-associated exonuclease Cas4 family.

21.116 kDa

MSLCINPSLIRQYLYCPMAAYYIAAGAPEPPTLRMQRGREIQQEAAQAAAKALGAERAEYSVHITAPPLCGTVDAVLWINGRPSPLEVKAAARPRRIPIHHKAQAAAYIAMVQRAYGRAVATAYIYYAESGQIAQIRMAKDLQELLNYAVSRLQQILQGKPPVLNPNPAKCQNCWYRKWCSHLPTTVEKI

cas4

CRISPR-associated exonuclease Cas4

183 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). This protein may be a 5' to 3' ssDNA exonuclease. Plasmid targeted by CRISPR locus P1 transform wild-type cells very poorly (PubMed:22767603).

Belongs to the CRISPR-associated exonuclease Cas4 family.

21.152 kDa

MSSTDVVEEYVQDERDPSRSPNVPITGLMVQYYHVCKRELWFMANGIDIDRETTNIQRGTHVDETSYGTSRRSFMIDNRIQLDILDSGDVMEVKVSSALEKPARMQLLFYLWYLREIHDIDKDGVLAYPTERKRESVVLDETTTAEVESTVRGVLDVVGRDSPPQLEKKPYCGTCLYQDLCWM

cas4

CRISPR-associated exonuclease Cas4

170 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). This protein may be a 5' to 3' ssDNA exonuclease.

Belongs to the CRISPR-associated exonuclease Cas4 family.

20.42 kDa

MENYLEEELIIGGIEINYLYVCKTKLWYFVRGITMEQESDFVDLGKFLHEKSYFGEEKEVQIGSIKIDFIKKRDVIEIHEVKRGKQMEKAHIMQVLYYIYYLNSLGIKSKAILHYPKLKEIKEIELKENNKEEIKRAIKEIEYIKSLKEPPEPIYQKICKNCAYYELCFI