cas21

CRISPR-associated endoribonuclease Cas2 1

105 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette (By similarity).

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

12.361 kDa

MPADHFLKRQAMSDFIICYDITDPRRLGRLYRYLIKRAVPLQYSVFLFRGDDRQLERCIQDAIELIDEKQDDLRVYPLPGRGLKARIGRPTLPEGIQWSGLPAKW

cas21

CRISPR-associated endoribonuclease Cas2 1

101 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Functions as a ssRNA-specific endoribonuclease, producing a 5'-phosphomonoester and a 3'-hydroxy. Does not process pre-crRNA in the manner expected if it were the CRISPR-processing endoribonuclease. Prefers U-rich substrates and often cuts between adjacent U residues in regions predicted to be single-stranded. RNAs as short as 10 residues can serve as substrate.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

11.936 kDa

MAMLYLIFYDITDDNLRNRVAEFLKKKGLDRIQYSVFMGDLNSSRLKDVEAGLKIIGNRKKLQEDERFFILIVPITENQFRERIVIGYSGSEREEKSNVVW

cas21

CRISPR-associated endoribonuclease Cas2 1

94 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Functions as a ssRNA-specific endoribonuclease.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

10.657 kDa

MLHLVVYDISDDGSRARLAKLLEKFGLQRVQYSAFRGELNPNDREVLARQVGKFVRDDRDCIFIIPLCQRCSSTAIVISNTGVELVKEKGVEFV