cas2-2

CRISPR-associated endoribonuclease Cas2 2

112 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

13.125 kDa

MPDGWRKMGVLVFYDLPVVSPEQRLAAVRFHKFLLADGFERMHYSIYARYCGSMERAATYERRVEQALPAVGHVNLLKLTDRQMVGMRKWIRGNYRAPENAEFVPPAQYQLF

cas2-2

CRISPR-associated endoribonuclease Cas2 2

93 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

11.325 kDa

MDFWLVCYDVRDDKRRRKLAKLLEQRCQRVQYSVFECPLPEKVLTDLLHRRWLKELNLKEDSLRAYPLQRQSRSQAKIFGSPDLYEPPDFLIL

cas2-2

CRISPR-associated endoribonuclease Cas2 2

91 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

10.575 kDa

MILIYDINTEDNDGKRRLVKIMKTSRKYLSHVQKSVFEGDITEGQISLLKKEIMAIVNMKKDFVIIYSLRDGVKLNREILTDTPDPTDNFL

cas2-2

CRISPR-associated endoribonuclease Cas2 2

91 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

10.295 kDa

MYVVVAYDITEDEVRNKVADALKAYGLERIQRSVFVGRINPALLKDLVERLKRITKGANADITIFKVDRRAIDTAIRIGPPPPARKNVDLY

cas2-2

CRISPR-associated endoribonuclease Cas2 2

91 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

10.679 kDa

MRLPYLVCYDISDEGRLNRVYRFMKGKGFHIQYSVFYCILTDVELKEMKAEILKLIHSRYDDVRIYPLPNNSLVAVLGVGDRIPDGVEVFY

cas2-2

CRISPR-associated endoribonuclease Cas2 2

89 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

10.64 kDa

MVRLVITYDIRKDKIRNKLFRLLERYGAWKQYSVFELEINPVHKVELFHSIADLIEDTDRVRIYDLCERCQGKITELGEVSPDKMQVVI

cas2-2

CRISPR-associated endoribonuclease Cas2 2

85 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endoribonuclease Cas2 protein family.

9.922 kDa

MQCLVIYDIPNDRARQRVADACLDYGLQRIQYSAFAGNLSRTHQRALFGEITRRVKGHTANVQLFVFDSKTWSDRRILEQQYDDA