cas1-2

CRISPR-associated endonuclease Cas1 2

344 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

37.851 kDa

MKKLLNTVYVTTEGTGLRKDGENLVAELDGVQKGRVPLHMVGSVVVFGGTYVSPGLMGACAAHGITIVLLDRVGRFQARVEGPVAGNVLLRRAQYKASEAPEDIVKSLILGKVSNQRAVLLRALRDHGADFPAAEALAVKDAIDRMAHILRKVGASAEDADHLRGAEGEAASLYFGVFGQLIRSPDGDFAFRGRSRRPPLDPTNALLSFLYTLLTHDCRSACESVGLDPAVGFLHRDRPGRPSLALDLMEELRPVLVDRLALSLINRRQLRATDFQRLDGGAVLLTDEARKTVLSAWQERKKQERRHPFLEESAPLGLVPYLQAQMLARHLRGDLDAYPPWFWK

cas1-2

CRISPR-associated endonuclease Cas1 2

344 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

37.851 kDa

MKKLLNTVYVTTEGTGLRKDGENLVAELDGVQKGRVPLHMVGSVVVFGGTYVSPGLMGACAAHGITIVLLDRVGRFQARVEGPVAGNVLLRRAQYKASEAPEDIVKSLILGKVSNQRAVLLRALRDHGADFPAAEALAVKDAIDRMAHILRKVGASAEDADHLRGAEGEAASLYFGVFGQLIRSPDGDFAFRGRSRRPPLDPTNALLSFLYTLLTHDCRSACESVGLDPAVGFLHRDRPGRPSLALDLMEELRPVLVDRLALSLINRRQLRATDFQRLDGGAVLLTDEARKTVLSAWQERKKQERRHPFLEESAPLGLVPYLQAQMLARHLRGDLDAYPPWFWK

cas1-2

CRISPR-associated protein Cas1 2

334 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

38.187 kDa

MKLVVDGFGKSVAKRDNQIVIKENGKEINYYLAKDISQILLTGKGSITFDALTLLAENDVDCVSINWKGHVDYRLSAPDRKNAIVKKEQYFALTDSRSGYLAKAFVRAKIENQKAVLGTLAKSREEKDYIIEQREKVSEHIGKIEKLSNINSDNIRNNILGIEGQASHEYWSAFASVLDEKWEFFGRSGRGAKDPVNSLLNYGYAVIESEIWKSIYLAGLDPYCGFLHSERYGRASLVYDLIEEFRQQIVDKTVLSIVNRNQITPDDFEEDGNYIKIHERARRLLIAKILDKLNSKIMFHSKNISYSDIILYQGKLMADYLTNGVPYEGFSLRW

cas1-2

CRISPR-associated protein Cas1 2

334 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

38.187 kDa

MKLVVDGFGKSVAKRDNQIVIKENGKEINYYLAKDISQILLTGKGSITFDALTLLAENDVDCVSINWKGHVDYRLSAPDRKNAIVKKEQYFALTDSRSGYLAKAFVRAKIENQKAVLGTLAKSREEKDYIIEQREKVSEHIGKIEKLSNINSDNIRNNILGIEGQASHEYWSAFASVLDEKWEFFGRSGRGAKDPVNSLLNYGYAVIESEIWKSIYLAGLDPYCGFLHSERYGRASLVYDLIEEFRQQIVDKTVLSIVNRNQITPDDFEEDGNYIKIHERARRLLIAKILDKLNSKIMFHSKNISYSDIILYQGKLMADYLTNGVPYEGFSLRW

cas1-2

CRISPR-associated endonuclease Cas1 2

330 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

39.19 kDa

MKKSLYIISDGELKRKDNTLYFETSEERKYIPVENTREILIFGEVSMNKRLLEFLTESEIIIHFFNYYGYYIGSFYPREHLNSGYMILKQAEHYLDTGKRLNLAEKFVSGAIENIKKVLIYYHNRGKELSEIISKIQEIATNIPDCSTTDELMAIEGNIRDYYYQSFDIILDNEHFIFETRTKRPPKNRINALISFANSLVYTTCLSEIYQTHLDPRIGYLHATNFRRFTLNLDVAEIFKPIIADRAIFSIVNKRIVKPQHFEKKLDGIVLNDKGKQILLQEMDERLRSTIQHKKLGRHVSYRQLIRLELYKIQKHLMEEEEYKPFVTGW

cas1-2

CRISPR-associated endonuclease Cas1 2

330 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

39.19 kDa

MKKSLYIISDGELKRKDNTLYFETSEERKYIPVENTREILIFGEVSMNKRLLEFLTESEIIIHFFNYYGYYIGSFYPREHLNSGYMILKQAEHYLDTGKRLNLAEKFVSGAIENIKKVLIYYHNRGKELSEIISKIQEIATNIPDCSTTDELMAIEGNIRDYYYQSFDIILDNEHFIFETRTKRPPKNRINALISFANSLVYTTCLSEIYQTHLDPRIGYLHATNFRRFTLNLDVAEIFKPIIADRAIFSIVNKRIVKPQHFEKKLDGIVLNDKGKQILLQEMDERLRSTIQHKKLGRHVSYRQLIRLELYKIQKHLMEEEEYKPFVTGW

cas1-2

CRISPR-associated endonuclease Cas1 2

325 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

35.724 kDa

MPPVSSARNLKELPKFRDGLSYLYVEHAVVEREAGGIGIYDQEGLTLAPVAGLGVLFLGPGTRITHAAVRLLAENGCTVAWVGEGMARFYAQGLGDTRSAARFYRQARAWADPALHLEVVMRLYRMRFSEPLPEGLTLEQVRGLEGVRVRNAYARWSRETGVPWYGRSYDRGNWRAADPVNRALSAGASYLYGLAHAAIVSLGFSPALGFIHTGKLLSFVYDIADLYKADYLVPAAFRTVAESEEAVERRVRRALREAIQEGRLLERMAEDLLNLFRGLGLPEEEDPVEEDPTRPGGLWDLEGEVEGGVAYGGDDPGEGAEEPEG

cas1-2

CRISPR-associated endonuclease Cas1 2

325 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

35.724 kDa

MPPVSSARNLKELPKFRDGLSYLYVEHAVVEREAGGIGIYDQEGLTLAPVAGLGVLFLGPGTRITHAAVRLLAENGCTVAWVGEGMARFYAQGLGDTRSAARFYRQARAWADPALHLEVVMRLYRMRFSEPLPEGLTLEQVRGLEGVRVRNAYARWSRETGVPWYGRSYDRGNWRAADPVNRALSAGASYLYGLAHAAIVSLGFSPALGFIHTGKLLSFVYDIADLYKADYLVPAAFRTVAESEEAVERRVRRALREAIQEGRLLERMAEDLLNLFRGLGLPEEEDPVEEDPTRPGGLWDLEGEVEGGVAYGGDDPGEGAEEPEG

cas1-2

CRISPR-associated endonuclease Cas1 2

322 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

37.261 kDa

MRKKNYYLVSDGKLRRHENTIYFENEDGKRPIPINSIYAIYALGSLSITSKAISLLAKEGVCIHFFNRYGYYIGSFYPRESLVSGEVVLRQAEHHLDSEKRLHLARAFVEGAILNMARVLKKAEQDDSDVIASLQHLSSAKSIVELMGAEAAARNAYYTKFDEILKNFEFGKRSRMPPENEVNAMISFGNSLLYSAVLSEIYHTQLNPAISYLHEPSERRFSLALDIAELFKPVIVDRLIFYLVNNGIVTESDFDSRLGGILLSEEGKKKFVRHFNERLEKTVKHRKLNRKVSYQRLIRLECYKLVKHFTAVEKYSPFVMWW

cas1-2

CRISPR-associated endonuclease Cas1 2

322 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

37.261 kDa

MRKKNYYLVSDGKLRRHENTIYFENEDGKRPIPINSIYAIYALGSLSITSKAISLLAKEGVCIHFFNRYGYYIGSFYPRESLVSGEVVLRQAEHHLDSEKRLHLARAFVEGAILNMARVLKKAEQDDSDVIASLQHLSSAKSIVELMGAEAAARNAYYTKFDEILKNFEFGKRSRMPPENEVNAMISFGNSLLYSAVLSEIYHTQLNPAISYLHEPSERRFSLALDIAELFKPVIVDRLIFYLVNNGIVTESDFDSRLGGILLSEEGKKKFVRHFNERLEKTVKHRKLNRKVSYQRLIRLECYKLVKHFTAVEKYSPFVMWW

cas1-2

CRISPR-associated endonuclease Cas1 2

321 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

38.132 kDa

MRTYYIFSSGRLRRMDNTLALELETERRVVPVEDIDHIYCFSELDLNTRLLDFLAQKQICLHFFNYYGHYSGSFIPRESQLSGFLLVRQVEHYLDQAKRLELARTFVEGALHNIRRNLEKREYDDICSKLDEIREGIGKTASIEELMSLEAHARKAYYDTWEEITGWEFGSRSKRPPANALNALISFGNAMMYTVVLKEIYRTALNPTISYLHEPSERRYSLALDVAEIFKPVFVDRLIFRLINLNMLKETHFDTNVNFVYLTEGGRKVFVKEFEETLEKTILHRKLKRNIRYKSLVRLDLYKLIKHLLGEEKYSPMKVWW

cas1-2

CRISPR-associated endonuclease Cas1 2

321 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

38.132 kDa

MRTYYIFSSGRLRRMDNTLALELETERRVVPVEDIDHIYCFSELDLNTRLLDFLAQKQICLHFFNYYGHYSGSFIPRESQLSGFLLVRQVEHYLDQAKRLELARTFVEGALHNIRRNLEKREYDDICSKLDEIREGIGKTASIEELMSLEAHARKAYYDTWEEITGWEFGSRSKRPPANALNALISFGNAMMYTVVLKEIYRTALNPTISYLHEPSERRYSLALDVAEIFKPVFVDRLIFRLINLNMLKETHFDTNVNFVYLTEGGRKVFVKEFEETLEKTILHRKLKRNIRYKSLVRLDLYKLIKHLLGEEKYSPMKVWW

cas1-2

CRISPR-associated endonuclease Cas1 2

307 amino acids

In vitro catalyzes a concerted transesterification reaction on branched DNA, as would be expected during integration of protospacers into the CRISPR leader sequence; Cas2 is not required in vitro. This reaction requires a 3'-OH group at the branch point (PubMed:26284603). Binds ss- and dsDNA and ss- and dsRNA with approximately equal affinity. May be able to anneal complementary DNA strands (PubMed:19427858).

Belongs to the CRISPR-associated endonuclease Cas1 family.

34.895 kDa

MISVRTLVISEYGAYVYVKKNMLVIKKGDKKVEISPSEVDEILITVSCSISTSALSLALTHGISVMFLNSRETPWGILLPSIVTETVKTKKAQYEAIVVRKDNRYGEEIISSKIYNQSVHLKYWARVTGTKNDYKELLDKDEPAAARVYWQNISQLLPKDIGFDGRDVDGTDQFNMALNYSYAILYNTIFKYLVIAGLDPYLGFIHKDRPGNESLVYDFSEMFKPYIDFLLVRALRSGFRLKVKGGLIEENSRGDLAKLIRKGMEENVKEESDHNPKTLIQAIRAHAVKLASSIREGKEYRGFKLVM

cas1-2

CRISPR-associated endonuclease Cas1 2

307 amino acids

In vitro catalyzes a concerted transesterification reaction on branched DNA, as would be expected during integration of protospacers into the CRISPR leader sequence; Cas2 is not required in vitro. This reaction requires a 3'-OH group at the branch point (PubMed:26284603). Binds ss- and dsDNA and ss- and dsRNA with approximately equal affinity. May be able to anneal complementary DNA strands (PubMed:19427858).

Belongs to the CRISPR-associated endonuclease Cas1 family.

34.895 kDa

MISVRTLVISEYGAYVYVKKNMLVIKKGDKKVEISPSEVDEILITVSCSISTSALSLALTHGISVMFLNSRETPWGILLPSIVTETVKTKKAQYEAIVVRKDNRYGEEIISSKIYNQSVHLKYWARVTGTKNDYKELLDKDEPAAARVYWQNISQLLPKDIGFDGRDVDGTDQFNMALNYSYAILYNTIFKYLVIAGLDPYLGFIHKDRPGNESLVYDFSEMFKPYIDFLLVRALRSGFRLKVKGGLIEENSRGDLAKLIRKGMEENVKEESDHNPKTLIQAIRAHAVKLASSIREGKEYRGFKLVM

cas1-2

Putative CRISPR-associated endonuclease Cas1 2

303 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette (By similarity).

Belongs to the CRISPR-associated endonuclease Cas1 family.

34.274 kDa

MGGFGAHIKSNRTEITIQHKGKITDIPIKDLSHFLLIGGHTIQTSTITSLVKEGVFISFCESDGEPVGYISPYDYSLFKEIQNLQKTAAPYSYALACANESIKSRILAIEKYAEEIGPEILFSGELDILTGYAKELENMVLIEELRRIEQLVRDMYYEILGRLISPTYLFKRRTSRPYLDPVNAIFSFGYGMLSSACTRAVIGGHLDPGHGYLNRGNQALVQDLMNCWKPKMIDNHAIGFLRSGRLHQNGYERTKDRCILHDEVIEELIHLFSKSIQEELINTQIDVLIQSLRGEAQFSIIKP

cas1-2

Putative CRISPR-associated endonuclease Cas1 2

303 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette (By similarity).

Belongs to the CRISPR-associated endonuclease Cas1 family.

34.274 kDa

MGGFGAHIKSNRTEITIQHKGKITDIPIKDLSHFLLIGGHTIQTSTITSLVKEGVFISFCESDGEPVGYISPYDYSLFKEIQNLQKTAAPYSYALACANESIKSRILAIEKYAEEIGPEILFSGELDILTGYAKELENMVLIEELRRIEQLVRDMYYEILGRLISPTYLFKRRTSRPYLDPVNAIFSFGYGMLSSACTRAVIGGHLDPGHGYLNRGNQALVQDLMNCWKPKMIDNHAIGFLRSGRLHQNGYERTKDRCILHDEVIEELIHLFSKSIQEELINTQIDVLIQSLRGEAQFSIIKP

cas1-2

CRISPR-associated endonuclease Cas1 2

296 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

33.099 kDa

MKSNTLGDEGNPARLLIKVTRETLPQVKEKYPFLYLEKGRIEIDDSSIKWIDCDCNVVRLPVAMLNCILLGPGTTVTHEAVKVMAAANCGICWVGDDSLMFYASGQTPTSNTRNMTHQMKLAANPAKALEVARRLFAYRFPDANLENKTLPQMMGMEGLRVRKLYEEMAVKYKVGWKGRRFEPGKFEMSDTTNKILTASNAALYSIILSAVHSMGYSPHIGFIHSGSPLPFIYDLADLYKQQVSIDLAFSLTADMAGYYDRHKIASEFRKRVIEIDLLGKIGPDIETILGKKQCSS

cas1-2

CRISPR-associated endonuclease Cas1 2

296 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

33.099 kDa

MKSNTLGDEGNPARLLIKVTRETLPQVKEKYPFLYLEKGRIEIDDSSIKWIDCDCNVVRLPVAMLNCILLGPGTTVTHEAVKVMAAANCGICWVGDDSLMFYASGQTPTSNTRNMTHQMKLAANPAKALEVARRLFAYRFPDANLENKTLPQMMGMEGLRVRKLYEEMAVKYKVGWKGRRFEPGKFEMSDTTNKILTASNAALYSIILSAVHSMGYSPHIGFIHSGSPLPFIYDLADLYKQQVSIDLAFSLTADMAGYYDRHKIASEFRKRVIEIDLLGKIGPDIETILGKKQCSS

cas1-2

CRISPR-associated endonuclease Cas1 2

295 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

32.343 kDa

MQIVVASYGARIRAKKGLLIVEGREGRREYPLHQVDEVLLLTGGISISTRALRALLRAGAVVAVFDQRGEPLGIFMKPVGDATGAKRLCQYAAATDGRGLQLAKKWVWLKIRGQLENLKRWRRRLGKYGTYAESISKAINALASAATPREVMEAEAAAAEAYWAAYREITGFPGRDQEGRDPVNAGLNYGYGILKALCFKSILLAGLDPYVGFLHADKSGRPSLVLDFMEQWRPRVDAVVAQLAEELEAENGLLTHKSRLRLAAAVLEEFNATGRPLSAEIHREARSIAKALCTS

cas1-2

CRISPR-associated endonuclease Cas1 2

295 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

32.343 kDa

MQIVVASYGARIRAKKGLLIVEGREGRREYPLHQVDEVLLLTGGISISTRALRALLRAGAVVAVFDQRGEPLGIFMKPVGDATGAKRLCQYAAATDGRGLQLAKKWVWLKIRGQLENLKRWRRRLGKYGTYAESISKAINALASAATPREVMEAEAAAAEAYWAAYREITGFPGRDQEGRDPVNAGLNYGYGILKALCFKSILLAGLDPYVGFLHADKSGRPSLVLDFMEQWRPRVDAVVAQLAEELEAENGLLTHKSRLRLAAAVLEEFNATGRPLSAEIHREARSIAKALCTS