cas1-1

CRISPR-associated endonuclease Cas1 1

352 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

41.079 kDa

MVHKVSQREFSRCYKRNCDCICRKPKQRRNVYLNYSLELLITIFKEVIPNLPMDKKIAFVKDYGAYLKVEKGLITCKIKNQVKWSIAPTELHSIVVLTNSSISSEVVKVANEYGIEIVFFNKHEPYAKLIPAKYAGSFKVWLKQLTAWKRRKVEFAKAFIYGKVHNQWVTLRYYERKYGYNLTSQELDRLAREITFVNTAEEVMQKEAEAAKVYWRGVKSLLPKSLGFKGRMKRVSDNLDPFNRALNIGYGMLRKVVWGAVISVGLNPYIGFLHKFRSGRISLVFDLMEEFRSPFVDRKLIGLARESADKVTDLKTVYSLFSDVKEDEIYTQARRLVNAILNDEEYRPYLAK

cas1-1

CRISPR-associated endonuclease Cas1 1

345 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Acts as a dsDNA and ssRNA nuclease, binds to linear and circular dsDNA and linear ssRNA and ssDNA.

Belongs to the CRISPR-associated endonuclease Cas1 family.

39.046 kDa

MRLVVDGFGKYLGIENGLIVVKEKGKALRKVRPEDLKQVLIIGKAAISSDAIKLLLKNRVDVVFLDFNGEILGRLSHPLIGTAKTRREQYLAYGDKRGVHLAKEFIKAKMANQMAILTNLAKARKDSNPEVAESLLKAKKEIDACLNELDGVEAEMIDKVRERLLGIEGKASKHYWDAISLVIPEEYRFNGRRGIEIGSPRYAKDIVNAMLNYGYSILLAECVKAVELAGLDPYAGFLHVDVSGRSSLAIDLMENFRQQVVDRVVLRLISYRQIKPEDCEKRNMVCQLSDNARRLLLASLLERLDSKTQYRGRNLAYSSIILLHARDVVAFLRGERRYEGFVQKW

cas1-1

CRISPR-associated endonuclease Cas1 1

343 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

38.756 kDa

MKKHLNTLFVTTQGSYLSKEGECVLISIDRVEKTRIPLHMLNGIVCFGQVSCSPFLLGHCAQLGVAVTFLTEHGRFLCQMQGPVKGNILLRRAQYRMADNYDQTATLARLFVIGKIGNARVTLARALRDHPEKTDGEKLKNAQHVLAGCIRRLQEATDQELIRGIEGEAAKAYFSVFDECITADDPAFRFEGRSRRPPLDRVNCLLSFVYTLMTHDIRSALESCGLDPAAGFLHKDRPGRPSLALDMLEEFRSYIGDRLVLSLINRGQIHAKDFDISETGAVAMKDDARKTLITAYQQRKQEEIEHPFVGEKMAVGLLWHMQAMLLARYIRGDIDMYPPFVWR

cas1-1

CRISPR-associated endonuclease Cas1 1

343 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

39.065 kDa

MHILLNTLYLMTPRTLVRLDHETVKIEVEGELKMQIPLHHLGSIVCFGDVTLTTPLIMRCAEDKRLIVFHDQHGRFKARVEGPVSGNVFLRHAQHEALSDSKKTTAIARNIVAGKIRNTRQVVLRGAREADNEDDRKALQETARELAHGLDALSRSPDLEQIRGIEGNAARHYFATLDRMVRVNREAFKITHRNRRPPLDRMNALLSYIYALLLNDCLSAAEGVGLDPQIGYLHVLRSGRPALALDLMEEFRAILADRLALTLVNRRQIDERDFVERPGGAVHINDNARKEIAIAYQKRKQEEVLHPVLNRKVPLGLVPHIQARLLARVLRGDAEEYLPFMYR

cas1-1

CRISPR-associated endonuclease Cas1 1

331 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

36.741 kDa

MNSVLITGAGYRIRKRGDVLTIETGKDSDTAEPPRTLSPLGLDLLAIAGDHSISTAAVRLVTSHGGAIALMDGLGNPFGHFLPLGRSALIEQYEAQASAPEERRLEIARSICTGALENKRTLLSNLERIRGFDLSREIRLVEDAQDKALECQSLDSLRGVEGSGAHAYFQGFSLAFDEEWGFLGRSQNPATDPVNSLLSYGYGMLYIQARQALVLSGYSPYYGAYHETYKKQEALVYDLVEEFRQPVVDRTVVTFLAKHMATPDDFTYPDEGGCMIGTMAKKKYAAAVLTRIHGKVKYEEQTFQDIFKRQAERIGKALTEGDEYVPYRYRT

cas1-1

CRISPR-associated protein Cas1 1

322 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

37.88 kDa

MSKKNYYLLSEGILKRKENTIYFVNEKGSKPLPINKIYSMYAYGQITISSQVISLFAKEGIPIHFFNYYGYYNGSFYPRESLLSGDLLIKQAEHNIDFSKRLKLAKLFVEGAAKNILKVLAYYKIENNIKNTLTELNESSKITEVMNVEGRIRAEYYQYFDDILPDEFKMEGRSRQPPTNMINSLISFGNSMMYASVITELYNTQLNPTISYLHEPAERRFSLALDLSEIFKPIIVDRVIFYLVNKKMITEKDFNQDLNCCLLNDKGRATFVKEYNKRLETTIKHKDLGRKVSYQRLIRLEAYKLKKHVFGMKEYDPFVIWW

cas1-1

CRISPR-associated endonuclease Cas1 1

318 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

36.548 kDa

MSTVFIDRKDIEIRVDGNSISFYAKGKKDGSLPLSPLKRVVIVGNVKIETSVLYKLVNHGITVLFLTGKLKYSGILNGPLHNNGLLRVKQYQKSLSGFSLKFAKELIKRKIVSQRDFLSEIREIKKALAMQADRAIEILNKAISNIEVTPISIDSLRGIEGAASSIYFITYSKIFPNSLKFVRRIKRPPKDPVNAMLSLCYTLLHYEIVREIQLIGLDPTIGFYHQFEYGRESLACDLVELFRVNVDRFVYELFKAKHLGNRDFMKDEESGGVYLKKTGRKKFYPLYEQWVQQQRTIWRGEVQGFARRILEEKDIISG

cas1-1

CRISPR-associated endonuclease Cas1 1

318 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

36.548 kDa

MSTVFIDRKDIEIRVDGNSISFYAKGKKDGSLPLSPLKRVVIVGNVKIETSVLYKLVNHGITVLFLTGKLKYSGILNGPLHNNGLLRVKQYQKSLSGFSLKFAKELIKRKIVSQRDFLSEIREIKKALAMQADRAIEILNKAISNIEVTPISIDSLRGIEGAASSIYFITYSKIFPNSLKFVRRIKRPPKDPVNAMLSLCYTLLHYEIVREIQLIGLDPTIGFYHQFEYGRESLACDLVELFRVNVDRFVYELFKAKHLGNRDFMKDEESGGVYLKKTGRKKFYPLYEQWVQQQRTIWRGEVQGFARRILEEKDIISG

cas1-1

CRISPR-associated endonuclease Cas1 1

318 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

36.558 kDa

MKHLIISEYGIYLGLESGRLVVKNKDDKKYFPLNRLATLSIAKKGVSFSSDLVEQFSLRGIKLFFLDFRGVAHSMLVGANQHAVVQARINQYRYIDRNALTLSIKLIAAKIKNQRATLNYFNKHHKSINLLNAIEELKRVAQLIKNAKTLNDVLGYEGYAANIYFSSLAKDKFLSASFANREGRGSQEIANSMLNFGYAILSSYILNAITNAGLEPYLGFLHQKRPGKMSLVLDLMEEYRAWVVDRVVIKLREQYKNKQYIDTKLKSILISEIQATIAKKYIYNGKKLKLEHIIQRQVYRLSGEFAGEHNYKPYIFKW

cas1-1

CRISPR-associated endonuclease Cas1 1

315 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

34.819 kDa

MTLHLTRQGATLRLRQGRLLLEEEGREVAGFPARQVRSVALWGNVRLSTPALVFLLRQGVPVFFYSLEGFLHGVAGAYPDPHPAHLRAQFAAEGLPLARAFVVGKLRSALALLERHRLPEAGGVVEALARAEGASELERLRGAEGEGSRVYFQGLARLLGPYGFGGRTRRPPRDPVNAALSYGYALLLGRVLVAVRLAGLHPEVGFLHAEGRRSPALALDLMEEFRVPVVDQVVLSAFRRGLLTPSHAEVREGGVYLNEEGRRRLIQLFEERLLEGVSHPLGFRKPLGETIEVQAQRLKAALLGRGRYTPFYLWR

cas1-1

CRISPR-associated endonuclease Cas1 1

313 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

34.305 kDa

MADPAFVPLRPIAIKDRSSIVFLQRGQLDVVDGAFVLIDQEGVRVQIPVGGLACLMLEPGTRITHAAIVLCARVGCLVIWVGERGTRLYAAGQPGGARADRLLFQARNALDETARLNVVREMYRRRFDDDPPARRSVDQLRGMEGVRVREIYRLLAKKYAVDWNARRYDHNDWDGADIPNRCLSAATACLYGLCEAAILAAGYAPAIGFLHRGKPQSFVYDVADLYKVETVVPTAFSIAAKIAAGKGDDSPPERQVRIACRDQFRKSGLLEKIIPDIEEILRAGGLEPPLDAPEAVDPVIPPEEPSGDDGHRG

cas1-1

CRISPR-associated endonuclease Cas1 1

302 amino acids

CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Acts as a dsDNA endonuclease. Involved in the integration of spacer DNA into the CRISPR cassette.

Belongs to the CRISPR-associated endonuclease Cas1 family.

33.382 kDa

MEVVVKDWGVSLGYSRGALVIKKRGGVDRIPLFQVDRIWILTGGVSISSRLVRALSHHFIDVVFFDAKGNPVARLFPPEANGTVTHRRAQYEAYLTGRGFELAKLVTYGKLINQARALRRLGQWKREHYGALAEAASKIADLAGRIPSCADVQCVLGHEGAAASLYWDAVSKTTGLPGRNPEAADPLNLALNYGYGVLKYAVWRQAVIHGLDPYAGYIHADKSGRPSLVLDLMEEFRPHVDLLVIRLRPSADWADGGVLKREIRAMLVEEWTGERLEPVIARQVGLAVAHLHGQRAYTPHQL