carC

Caffeyl-CoA reductase-Etf complex subunit CarC

379 amino acids

The Caffeyl-CoA reductase-Etf complex catalyzes the reduction of caffeyl-CoA to yield hydrocaffeyl-CoA. It couples the endergonic ferredoxin reduction with NADH as reductant to the exergonic reduction of caffeoyl-CoA with the same reductant. It uses the mechanism of electron bifurcation to overcome the steep energy barrier in ferredoxin reduction. Also reduces 4-coumaroyl-CoA and feruloyl-CoA.

Belongs to the acyl-CoA dehydrogenase family.

41.436 kDa

MYFSEQNKMIRKLARDFAEKELTTEILDEVEESGEFPQEILDKMAKFGFFGIKIPKSLGGSGGDHMSYVICMEEFARVSGVASVYLSSPNSLAGGPLLLSGTEEQIEKYLKPIITGKKKLAFALTEPGAGSDAGGMSTTAVDMGDYYLLNGRKTFITMAPLCDDAVIYAKTDMSKGTRGISAFIVDLKSEGVSMGKNEHKMGLIGCATSDIIMEDVKVPKENRLGEVNKGFSNAMKTLDVGRLGVASQSIGVAQGALDEAIKYAKERKQFGKRIADFQAIAFMIADMATKLEAAKLLVYNAASLMDNKKNATKEASMAKFYASEICNEICAKAVQIHGGYGYIKEYKVERMYRDCRVFTIYEGTSQVQQMVISGMLLKK

carC

2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase

290 amino acids

Involved in the degradation of carbazole, a toxic N-heterocyclic aromatic compound containing dibenzopyrrole system. Catalyzes the hydrolytic cleavage of a carbon-carbon bond of 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid (HOPDA) to yield anthranilate. CarC is specific for 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid (6-phenyl-HODA), and has little activity toward 2-hydroxy-6-oxohepta-2,4-dienoic acid and 2-hydroxymuconic semialdehyde. The effect of the presence of an amino group or hydroxyl group at the 2'-position of phenyl moiety of 6-phenyl-HODA on the enzyme activity is found to be small.

Belongs to the DmpD/TodF/XylF esterase family.

32.252 kDa

MLNKAEQISEKSESAYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVETAYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSRRADITRAAA

carC

(5R)-carbapenem-3-carboxylate synthase

273 amino acids

Catalyzes the Fe(2+) and alpha-ketoglutarate-dependent conversion of (3S,5S)-carbapenam to (5R)-carbapenem, an essential step in carbapenem antibiotic biosynthesis.

Belongs to the TfdA dioxygenase family.

31.611 kDa

MSEIVKFNPVMASGFGAYIDHRDFLEAKTETIKNLLMRQGFVVVKNLDIDSDTFRDIYSAYGTIVEYADEKIGVGFGYRDTLKLEGEKGKIVTGRGQLPFHADGGLLLSQVDQVFLYAAEIKNVKFRGATTVCDHALACQEMPAHLLRVLEEETFEVRVLERGYYVDVSPDGWFKVPVFTDLGWVRKMLIYFPFDEGQPASWEPRIVGFTDHETQAFFQELGAFLKQPRYYYKHFWEDGDLLIMDNRRVIHEREEFNDDDIVRRLYRGQTADI