Protein
Blood vessel epicardial substance-B
Function
Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Plays a role in vamp3-mediated vesicular transport and recycling of different receptor molecules. May be involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. May induce primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. May be involved in epithelial movement during corneal sheet formation and regeneration. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May also be involved in striated muscle regeneration and in the regulation of cell spreading (By similarity).
Similarity
Belongs to the popeye family.
Sequence
MATESILITTLPMDFNSQMNNVTIGLNDNETLCENWREIHHLVFHLANACFAAGLVIPSTLNLHMIFLRGMLCLGCTFFIIWAVLFRCALDIMIWNATFLIINFMHFVYLVYKKRPIKVKNDLKDIYHRMFEPLHVSPELFNRLTGQFCEMKTLAKGQTYAVEDKTSVDDRLSLLLMGIMKVSYRGHFLHTISANAYIDSPEFRSTEMNRGETFQVTITADENCVFLCWSRERLTYFLESEPFLYEIFKYLIGKDITTKLYSLNDPTLGKKKKLDTQPSLCSQLSVMEMRNSLASTSDHEDGLQNFLRGTSTTSSQRHNQQEFYNAYGVGPLSHAVFC