Function
Required for the homologous recombination repair of DNA double strand breaks, thereby playing a role in chromosome integrity (PubMed:15798199, PubMed:16843491). Acts by targeting rad-51 to sites of DNA damage and stabilizing rad-51-DNA filaments by blocking ATP hydrolysis catalyzed by rad-51 (PubMed:15798199, PubMed:16843491, PubMed:17483448, PubMed:18779660). Promotes rad-51 mediated displacement-loop (D-loop) formation during strand invasion between the invading single-stranded DNA (ssDNA) and the homologous duplex DNA (PubMed:16843491). Also functions independently of rad-51 in DNA double-strand break (DSB) repair by promoting DNA single-strand annealing (SSA) when the homologous recombination (HR) and non-homologous end joining (NHEJ) pathways are compromised (PubMed:15798199, PubMed:16843491). Binds selectively to single-stranded (ssDNA) via its C-terminus (PubMed:15798199). Involved in telomere maintenance and replicative senescence (PubMed:27761361).
Sequence
MGDSSKKVKDSFDTISEPDSFDEPKGVPISMEPVFSTAAGIRIDVKQESIDKSKKMLNSDLKSKSSSKGGFSSPLVRKNNGSSAFVSPFRREGTSSTTTKRPASGGFEDFEAPPAKKSTSSSSKKSKKHSKKEKKKEFKEIHADVLRVSRIYEKDKFRIILQESSSTPLILATCSYNRGSDIKFGDRIHVDAEVCKKSSSGDVTEIYIDRVLKNKENGAKSGIRRHSIAKKPFCIKPRFIHELSDTKIKKTVVQVNLLDLNLDFYAGCSKCKHSLPEAANQCEFCKDSQGKSELSMYSRVRVMDFSGQMFINVTTKNMKKLLDLLGYEGFDNWFRFKDPQERQNYVFRPVMVEIEKSNDEWECTDVAEVDWKDFGSYLKHKEDKKKRRSKKKHP