Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of rnf2 (By similarity).
Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRADKTLQDIVYKLVPGLFKGEMKRRRDFYAAHPSADVANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNKADRKGSKDKDKEKSKDEINDKRYLRCPAALTIMHLRKFLRSKMDIPSNFQIDVMYEEEALKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRVKINPHTDRINHTSGDMESDSGSDKAGSLGVVIPSTSSCIPSPPVQSPHPHFPHISSTINGTSSSSSSHQNPFTNRARKISLNGVSAISSG