baf-1

Barrier-to-autointegration factor 1

89 amino acids

DNA-binding protein which plays an essential role in nuclear envelope formation. Required for normal chromosome segregation during mitosis. Associates with the nuclear lamina via its interaction with LEM domain containing proteins emr-1 and lem-2 (By similarity).

Belongs to the BAF family.

9.922 kDa

MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFVEWLKETAGVTANHAKSAFNCLNEWAEQFI

baf-1

Barrier-to-autointegration factor 1

89 amino acids

DNA-binding protein which plays an essential role in nuclear envelope formation (PubMed:17170708). Required for normal chromosome segregation during mitosis (PubMed:12684533). Associates with the nuclear lamina via its interaction with LEM domain containing proteins emr-1 and lem-2 (PubMed:12684533). In association with lem-3, plays a role in radiation-induced DNA damage repair response (PubMed:22383942).

Belongs to the BAF family.

9.954 kDa

MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFIEWLKETAGVTANHAKTAFNCLNEWADQFM