azoR

FMN-dependent NADH-azoreductase

220 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.958 kDa

MATLLHIDSSVFPAEASASRSVTAAFRRTWEEQHPEGTVIYRDLAAVPVPHITADAWSAGYADPSERSTRQSAAFAARLELIEELERADVILIGAPMYNYTVPSTLKAWLDSVLLLGRTAGEAPSAQGTPTVVVASRGGSYAPGTPREDFEFVQNYLEAVLRSTLGLDLEFIVPELTMAPRNPAMSELLPLFESSRERAHSEAVTKAKELTERLTADNGR

azoR

FMN-dependent NADH-azoreductase

217 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.866 kDa

MSKLLHIDSSILGSNSVSRQLTAQIVASWRAAHPATEVSYLDLAMDSPSHLSVESLGFRLPAGTADLSEVQQRENAISEALVSQFMAADVLVIGAPLYNFSIPSQLKAWIDRVAQAGRTFKYTEKGPVGLAGGKTIIVASARGGMYSTSDAGNAMEHQESYLKTVFGFFGVTDVRFVRAEGLAMGEAAKAAALAAAQVEILAQTHSAANQPQAVLVA

azoR

FMN-dependent NADH-azoreductase

217 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.067 kDa

MATLLHIDSSVFPSAASASRAVAETFRTAWQEQHPDGTVIYRDLSANPVPHITADAHTAGFADPATHTPGQAAAFAEREKLIAELEQADAVLIGAPMYNYAIPSTLKAWLDNVILMGRTAANENSKVTGTPVTVIASRGGSYAPGTPREPYEYVQNYLKAVLSDALGLELEFIVPELTMAAHNPAMSELVPLAEASRAKAHEDAAAKAKELADRFAA

azoR

FMN-dependent NADH-azoreductase

216 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.541 kDa

MPTLLHLDASPRRRSISRDIGAAFADSWRATAPNGHYIHRDLAADPVPFIDAAWTEICDAVLAAGGTDLAALPTLVRTPAQAAAWRIVEPLLDELLAADVVLIGTPMYNYSIPAALKAWLDQVTFPRMSLAPRRFVVAAARGGSYSPGTPKAAFDHQERYLRDFFAGHFAVTDTVFVTAELANARQDPALAARRAEHDASYADALDTARRLGKEYR

azoR

FMN-dependent NADH-azoreductase

215 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.726 kDa

MKKLLYITVNSKPENLSASKTVGRAFVNRFLEKHSDFEIEELDLYKCHIPRLEYEYFEKRSCLVNEDAFNKLDKKQQEEVHKIVKLTDQFKEADVYVIAAPMWSMSFPAPLKEYIDCIVMDGKTVDIKDGEKPEGLLNDKPRGAVYIQSSGAKMNVLLKMVMDKGVHYIESIMKFMGIEKFEELLVDGTGTTEEEKNKAIEKAIENIDSVIDGIW

azoR

FMN-dependent NADH-azoreductase

215 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.757 kDa

MKKLLYITVNSKPEELSASKTVGRAFVNRFLEKHSDFEIEELDLYKCHIPRLEYEYFEKRSCLVNEDAFNKLDKKQQEEVHKIVKLTDQFKEADVYVIAAPMWSMSFPAPLKEYIDCIVMDGKTVDIKDGEKPEGLLNDKPRGAVYIQSSGAKMNVLLKVVMDKGVHYIESIMKFMGIEKFEELLVDGTGTTEEEKNKAIEKAFEKIDSVIDGIW

azoR

FMN-dependent NADH-azoreductase

214 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.803 kDa

MTRLLRIDASARHTGSFSRDLADLFVSGWLAHEPQAEIVVRDLVDAPVPHISELTIQGYYTPPAQMTPQLRTATALSDQLIAEIRRADVLLLSTPMYNFSIPSALKAWIDHIVRINETFSFDGARFAGLLPGKRAYVVTAAGAGGYTGDGPLAPANFVQPYLQFLLGFLGIADVTFVPIEQTTADAAAVADGRAAAASRIRTLVAGAVGAQQPA

azoR

FMN-dependent NADH-azoreductase

214 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.944 kDa

MPQLLHIDSSAELHNSTSRDLTALFAQQWSNNSPDHTTVTVDLHRDPLPHLADAALHYAPRLRVEGEIPDPAAEALQARVIEQLTAADVVVIGAPMYNWSIPSTLKAWIDYVHVLGTTVPFDTRTQPLAGKPVVIVSSRGNTYAPGSGNEANDHTVPPLVQVLGVSMGMDVSVITAELTLAQRIPAMAPLIEQGDASLRAARESLTELARTLGA

azoR

FMN-dependent NADH-azoreductase

213 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.272 kDa

MKKLLYISVNTKPEEMSSSKTVARKLINSILEKHPSMALEEVDLYREHIPQLKYSYFESRSAIVNSEALAKLPQDEQNEVTQIIKLCDQFRAADIYIIASPMWSLSFPAPLKEYIDCVVQSGKTIAFDENKPYGLLNDKERTFIYVQSSGANIPWIIRPALNKGLNYVHDIIRFLGISKFEELLVDGTGTTELERQEAIEKAASRIETLVDQI

azoR

FMN-dependent NADH-azoreductase

213 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.532 kDa

MKTLLVLNSSGRVTRSLTRRLTSRFAEAWSAVHHDAVVVQRDLTLNPPPTINEPWIVAAFAAPDTPATVREAVLRASDELLDELTAADAVVIGAPVYNFGLPAQLKAYVDQIVRVGRSFALTGDAAVPYRALLAPKPVVVMTAASDGVMLPGGALAHLNLVEPHLTAALGFIGLTDVRFVRVADSVADQAAHPHSLAAAERAIEMILPRLAAA

azoR

FMN-dependent NADH-azoreductase

213 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.81 kDa

MNTLIVNSHPDFSNPYSFTTILQEKFIELYNEHFPNHQLSILNLYDCVLPEITKEVLLSIWSKQRKGLELTADEIVQAKISKDLLEQFKSHHRIVFVSPMHNYNVTARAKTYIDNIFIAGETFKYTENGSVGLMTDDYRLLMLESAGSIYSKGQYSPYEFPVHYLKAIFKDFMAFDDFCVVRAEGTDILDRQVVLDKMNQDLREAFEAFYSKE

azoR

FMN-dependent NADH-azoreductase

213 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.81 kDa

MNTLIVNSHPDFSNPYSFTTILQEKFIELYNEHFPNHQLSILNLYDCVLPEITKEVLLSIWSKQRKGLELTADEIVQAKISKDLLEQFKSHHRIVFVSPMHNYNVTARAKTYIDNIFIAGETFKYTENGSVGLMTDDYRLLMLESAGSIYSKGQYSPYEFPVHYLKAIFKDFMAFDDFCVVRAEGTDILDRQVVLDKMNQDLREAFEAFYSKE

azoR

FMN-dependent NADH-azoreductase

213 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.81 kDa

MNTLIVNSHPDFSNPYSFTTILQEKFIELYNEHFPNHQLSILNLYDCVLPEITKEVLLSIWSKQRKGLELTADEIVQAKISKDLLEQFKSHHRIVFVSPMHNYNVTARAKTYIDNIFIAGETFKYTENGSVGLMTDDYRLLMLESAGSIYSKGQYSPYEFPVHYLKAIFKDFMAFDDFCVVRAEGTDILDRQVVLDKMNQDLREAFEAFYSKE

azoR

FMN-dependent NADH-azoreductase

212 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.955 kDa

MAKLLVIKASMVDKSISFSEELTNRFVKYYLESNPNDEVITLDLNEVPMAQKTLNGSNLKNFFNQEDSDFYIDQLKSVHKVIFSCPMTNFNISATAKNYLDHVLVANKTFSYKYSKKGDAIGLLNHLSVQLLTTQGAPLGWYPWGNHTENLKGTFEFMGTKVVTPILVDGTKIPENANKTPVERINEFDSVIRLKAKEFAALPAVDWKPLEQ

azoR

FMN-dependent NADH-azoreductase

212 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.017 kDa

MQVLHIDSSITGAASVSRQLTAQTVAALVAANPGAKVEYLDLAVNAPDHLNAVSMGFRTGQAATTEAERAQNAISEALVSQFLAADVVVVGAPFYNFTISSQLKAWIDRIAQGGRTFRYTAAGPEGLAKGKKVIVASTRGGVYSTSEMGQALEHQESYLKTVFGFLGITDVSIVRAEGVAMGDESKAKALESARSDIVRAAAAANQEAAIAA

azoR

FMN-dependent NADH-azoreductase

212 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.075 kDa

MSKLLYIEASPRKNKSFSTRVAQSFINTFLDADPANRIETLDLWDFPLPEVDGSYLSAKYKILHWQDPTEAEARAWTEIANIVSQFKDADSYLFSIPMWNFSIPYKLKHFIDIITQPGLTFMFSPESGYQGLVTGKACTVIYARGAQYRGTKGSTLDFQKTYMELLLSFIGFENIHSIRVEPTLTDSASRERVLATAKLEAISLAKELYSLI

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.79 kDa

MPHLLHIDSSLAPEGSVSRGVAEAYAESWRKHHPDGTLTHRDLATSPPPHLNWALVSGGQTPPEQRTPEQAEAVKIREEYLEEVESADEYVISVPMYNYAYPSTIKAWLDQVIVMGRTAGGTAGDGVLAGRKVTVITAQGGSYAPGAPKEGWDHQVPYLRHAFEALGADNIEFITVVMTLSKVNPALAAFTDVFEASRTAAEQTARDRAAA

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.717 kDa

MTKVLYITAHPHDDTQSYSMAVGKAFIETYKQVHPDHEVIHLDLYKEYIPEIDVDVFSGWGKLRSGKSFEELSDEEKAKVGRMNELCEQFISADKYVFVTPMWNFSFPPVLKAYIDAVAVAGKTFKYTEQGPVGLLTDKKALHIQARGGFYSEGPAAEMEMGHRYLSVIMQFFGVPSFEGLFVEGHAAVPEKAEEIKANAIARAKDLAHTF

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.689 kDa

MTNVLYITAHPHDDTQSYSMAVGKAFIDTYKQVHPDHEVIHLDLYKEYIPEIDVDVFSGWGKLRSGKSFEELSDEEKAKVGRMNELCEQFISADKYVFVTPMWNFSFPPVLKAYIDAVAVAGKTFKYTEQGPVGLLTDKKALHIQARGGFYSEGPAAEMEMGHRYLSVIMQFFGVPSFEGLFVEGHAAVPEKAEEIKANAIARAKDLAHTF

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.188 kDa

MTKVLYITGHPNDETVSNSMAAGKSFIESYKQSNPDHEVVHIDLYDTFIPLIDKEVFDGWGKLQSGKGFEALSETEQQKVARLNELSDEFAAADKYIFVTPMWNLSFPAVVKAYIDAVAVAGKAFKYTAEGAVGLLTDKKALLIQSRGGIYSEGPAADFELGNRYLQTILGFFGVPSVEELVIEGHNQMPEKAEEIKADGVRRAEALGKTF

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

24.004 kDa

MAKVLYITANPKQEQQSFSLSVGRAFLETYKQHHPEDEIVELHVYDTDIPYIDADVFSGWGKLQQGQAFEQLSKDEQQKVARINELCEQFMEADKYVFVTPMWNFSFPPKLKAYIDTICLAGKTFQYTEEGPVGLLKGKKALHIQARGGMYSEGPAKEMEFGDRYLRAVLSFIGITDVETIAVEGMNAFPNEAEAIKQQAIERAKDMAKRF

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.018 kDa

MAKVLYITAHPHDETVSYSMATAKAFIESYKEANPSDEVVHIDLYKENIPHIDADVFAGWGKLQSGAGFDTLSAEEQAKVARLNELSDQFVSADKYVFVSPLWNFSFPPVLKAYIDSVAVAGKTFKYTEQGPVGLLTDKKALHIQARGGYYTEGPAAELEAGHRYLGTIASFFGIPSFEGLIVEGHNAEPAKAEQIKADAIERAKALGKTF

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.35 kDa

MAKVLYITAHPHDEKTSYSMATGKAFIDSYKESNPNDEVVHIDLYKENIPHIDADVFSGWGKLQSGTGFEELSENEKAKVGRLNELSDQFAAADKYVFVTPLWNFSFPPVMKAYLDSVAVAGKSFKYTEQGPIGLLTDKKALHIQARGGYYSEGPAADMEMGHRYIGIMMNFFGVPSFDGLIVEGHNAEPNKAQQIKEDAIARAKEAGKSF

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.966 kDa

MTKVLYVSANPKPTELSYSKQVAETFVSTLKAENASIEVEAIELYDVDVQEIDGDVLSAWGKFASGEALTDVEAKKVGTMSGMLEKFMEADLYVFATPMWNFFFPARMKMFLDSVLMAGKTFRYTEQGPVGLLENKQAIHIQGTGGIYTGTDLNFADAYLRQALAFVGVSEVTTVAVEGMNQYPDKIEEIVADAKAKAEALAKEVAGAVTV

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.782 kDa

MPNLLHVDASLAQEGSTSRSLAATYIDAWRAAHPDGTVTYRDLALTPPPHLDWATLSAAFTPPEQHTPEQTEGVKLREELIGELEAADELLLSLPMYNYSVPSTFKAWVDQVILVGRTLQQPPAESVLTGDRVTVIATQGGSYGVGTPKEGWDHQLPFIAHVLESLGATDVELVRVEMTLAPVNPALADFTDVYERSRAAGESALRARAAA

azoR

FMN-dependent NADH-azoreductase

211 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.896 kDa

MPHLLHVDSSLATESSTSRSIATIFAEAWREAHPDGIITYRDLSVTPPPHLDWATVSARFTPPEQLSAEQAEAVKKGEELIAEVEAADEYLLSVPMYNYAVPSTFKAWIDQIIVMGRTVRQAPDDSALTGKKVTVVTAQGGSYGPGTPKEGWDHQQPYVAHILAALGATDIEFIRVEMTLAPVNPALAEFIDLFQRSKAEAAAAARLRASV

azoR

FMN-dependent NADH-azoreductase

210 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.634 kDa

MARLLYVTCNLKPLEISRSLSVGNEFLHEYLKQNPDDEVHFLDLYRDHIQRIDADVLSGWGKLRSGASLATLSDDEQRKVSRIWKHADQFIAADKYVFVTPMYNLGFPAEFKMYIDAVCVVGKTFTYTPAGAVGLLKNQGRKCLHIHSNGGFHYGKEEDHSVPYLKSIMGFMGIEDFESVVLEGVDAMPDLAEEFKQAAVIKAHLAAQSF

azoR

FMN-dependent NADH-azoreductase

210 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.669 kDa

MANILYITCNLKPREQSRSLTIGNEFLKRYSERHPEDRIDFLDLYRDPIQRIDTDVLNGWGKLRTGASFDLLSEDEVRKIGRIGALADQFVATDKYVFVTPMWNLGFPAELKMYIDTVCVVGKTFTYTESGAVGLLRGMGKKCLHIHSCGGFHCGSADDHSVPYLKSVMNFMGIEDFRSVVVEGMDALPHRAEEFMDKALAESREAAALF

azoR

FMN-dependent NADH-azoreductase

210 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.48 kDa

MAKLLYVTCNLKPTEFSCSLSVGKKFLDEYLRQNPADEVYFLDLYRDNIQRIDADVLSGWGKMRNGESFASLTTDEQRKVGHIWKHADQFIAADKYVFVTPMFNLGFPAELKMYIDAVCVVGKTFAYTPTGPVGLLKDQGRKCLHIHSSGGFHFGKEEDHSVPYLKSIMGFMGIEDFESIVVEGVDAIPDRAESFKGAAVEKARGVASQF

azoR

FMN-dependent NADH-azoreductase

210 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.356 kDa

MPHLLHLDSSADLATSRSRAVTAAFADTWRARGEEYTVTHRDLHRDPLPHFADAEQHWPAAARRPGANPPAEQDALTATLHAEVLAADVVLVGAPLYNYTVPSTLKVWLDHLHIPGVLAGEGSQPLAGRPAVVVSSRGATYDAGSPTEGWDHGVPVLRIVLGNSLGMDVHVVQTSATLADRLPEMAALKERGAAEFQAALAAARELARTL

azoR

FMN-dependent NADH-azoreductase

210 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.813 kDa

MSILLVTSSPRGAASHSTRIATEFAEKLLAADPSNTLVVRDLVANPLPHIDADYATGIYTPVEARTPRQAEVVGVSDVVLDELFAADTVILATGFINFNISSTLKSWVDHIARSGRSFAYGENGPKGLVTGKKVYIVLASGGIYSEGAAVQFDHAIPYLRGVLGFLGMTDVDVIRIEGVGMGPDAVTAALAKATAKVDAVVASQQAAAAA

azoR

FMN-dependent NADH-azoreductase

209 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.279 kDa

MTTESQSAVKTILHVESSLFGEGGVSSQLSTELVTKLQNKYADVNAKVNTNVKIVKRNLAAEPIPHLDLATITAIGEGKPVIGDTLIQELKDADIVVLGVPMYNFGVPSGLKAWFDHIARAGSTFKYTETGPVGLLENKKVYVVTSRGGYHKDAASDVEVPFLKTFLGFLGLNDVEFIYAEGLNLSGKREQGLADASAKIAALVGEEAA

azoR

FMN-dependent NADH-azoreductase

209 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.296 kDa

MKILQVNSSARNFANGVGSVSSQLAGELVARLRDGEPTASVVVRDLARTPHPVLDEAALQALFTPADQRTPAQAERVALDDALIAEIQAADVVVIAAPMFNFGITAQLKNWIDAIARAKVTFQYTANGPEGLLKGKRVHVVLTRGGVYRDQASDNQVPYLRQVLGFLGMTDVEFIYAERQGMGPEASAQGVAEAREQIAALLQLGTATA

azoR

FMN-dependent NADH-azoreductase

209 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.394 kDa

MKTLVILSSILGDRSNSKQLADHLLARLKQSEPGGTVKIRDLAADPVPYFDGATVGALFTPAEARNAQQQRIAALSDDLVAELFDADRIVFAVPVYNFNLPAQFKSYIDHIARAGVTFRYTAEGKPEGLVQGKQVLVLIARGGKSEGTPDDTMTPYLKQMLAFLGMTDVTFIAAEGMAMGELAAQEGLALARQRIDALSLDARQGLAAA

azoR

FMN-dependent NADH-azoreductase

209 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.427 kDa

MKTLVILSSILGDRSNSKQLADHLLARLKQSEPGGTVKIRDLAADPVPYFDGATVGALFTPAEARNAEQQRIAALSDDLVAELFDADRIVFAVPVYNFNLPAQFKSYIDHIARAGVTFRYTAEGKPEGLVQGKQVLMLIARGGKSEGTPDDTMTPYLKQMLAFLGMTDVTFIAAEGMAMGELAAQEGLALARQRIDALSLDARQGLAAA

azoR

FMN-dependent NADH-azoreductase

209 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.989 kDa

MATILYIKASPRGERSHSVTVADAFVKAYSEANPGDVVRVLDVFEADLPAFGTDAVVARYLSGQGDPLSPAQEAAWAAVKRQVEDFKTADKYVIALPMWNFSIPWRLKQFFDIIIQPGLTFSYDEQGYHGLVTGRPVLVSYARGGAYPAGTPAEGWDFQKRYLEHILGFIGFTDIRSVVVEPTLAGGPDTAQAKRAEAVEQARRMALEF

azoR

FMN-dependent NADH-azoreductase

209 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.989 kDa

MATILYIKASPRGERSHSVTVADAFVKAYSEANPGDVVRVLDVFEADLPAFGTDAVVARYLSGQGDPLSPAQEAAWAAVKRQVEDFKTADKYVIALPMWNFSIPWRLKQFFDIIIQPGLTFSYDEQGYHGLVTGRPVLVSYARGGAYPAGTPAEGWDFQKRYLEHILGFIGFTDIRSVVVEPTLAGGPDTAQAKRAEAVEQARRMALEF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.141 kDa

MSKVLFIKANDRPVEQATSVKLYEAFTKAYKETHPNDEIVELDLFAENLPYYGNDMLTAMWKAGNGIELSADEQKRADLVNKYLNQFTAADKVVFAFPMWNFTVPAVLHSYMDYLSQAGKTFKYTAEGPVGLMGDKKVALLSARGGVYSEGPMAQMEMANKYVRTILGFWGVNNVTEVIVEGHNQFQDKAAELVAAGVEKAVKLAESF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.93 kDa

MKTLLRIDSSARIEGSRSRRLGDALEARWRAGSPDGAVVRRDLAADPVPHIEATTIAGFFTPADQVTDAMRAATVLSDRLIGEVEAADALLITAPMYNFGLPSTLKAWIDHVVRIHRTVAYDGTTFRGLVTGKAAYVALAYGAGSYEPGGTLAPFDYAKPYLTHVLGFIGFRDIEVVGVEGTSGEEGAAAAALDAALKAIENLPSLAA

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.727 kDa

MSNLLVLNSSANTGESVSRILIDEAVNQILTAAPGTDVVRRDLGANPVPHLTTANLAGVRGTPSTSEELAARALSDELIAELKAAGTVIIAAPMYNFSVPTSLRSWFDFVLRAGETFKYSEAGPEGLLKGKKVVVLTSRGGLYSEGPAAAADFQEPYLRHLLGFVGITDVTFIHAEKIGFGPEARAAAITGAKGQIAKVAQTFSTVAA

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.99 kDa

MKILRIDSSPLGDASVSRQLTASIVAALRQATPDAEVSVRDLTVAPPDHLTGELMQVVKFRNLEGLTARQQEELALTDALVDEFLAADVVVIGAPMYNFTVPTQLKAWIDRIAQAGRTFRYTETGPVGLAGGKKVYIASTRGGVYSTNAAMSALDHQEAFLRTVLGFLGVTDVTVIRAEGVGMGPDARAKALAAAQQEIDALAVPVAA

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.034 kDa

MKTLVILSSILGDRSHSKQLADHLIQRLRQHEPDGSIRVRDLAADPVPYFDGATAGALFTPADQRTAEQAAIVARSDALVAELFDADRIVFAVPVYNFGLPAQLKSYIDQIARAGVTFRYTAQGVPEGLLKNKQVVVLSARGGKAEGTPADTLTPYLAQVLGFVGLVDPVFISAEGMAMGELAAQDGLALARQRIDALVAGAPQQVAA

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.773 kDa

MQVLHLDSSILGDASASRILTAAIVDELRRDNPGATVIHRDLAVEAIPHLDGAIAAGFRATGADGFDAVTLAEHARSEALVGELLASDVIVVGAPMYNFSVPSQLKAWIDRVAQAGRTFKYTETGPVGLTGGKKVIVASTRGGMYSAGPTAAMDFQEAYLKTVFGFLGITDVQFVRAERLAMGPDARAQALEAAHAAMHDVVNQAIAA

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity. The enzyme can also reduce a wide range of sulfonated azo dyes. The substrate preference order is methyl Red > Orange II > Ponceau BS > Ponceau S > Orange G > Amaranth.

Belongs to the azoreductase type 1 family.

23.221 kDa

MSKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAMTKATEYGKTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.353 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.353 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.353 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.352 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAANFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.353 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.362 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQHHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.353 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.333 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPEDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVLVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.365 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATIF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.353 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATTF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.365 kDa

MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATIF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.31 kDa

MSQVIYITAHPLDEMVSNSMAVGKAFIESYQESHPDDEVIHIDLFKDEVPEIDADVFSGWGKLQNGETLTEVEQHKVSRLTEIVDQFVSADKYVIATPMWNLSFPPAVKRYFDAVSVAGKSFKYTSEGPQGLLTDKTALHIQSRGGFYSEGPAAEVEMGDRYIRTIFSFLGVPKYKLIAVEGHNKVPERAEEIKLNAIQQAESFAKEF

azoR

FMN-dependent NADH-azoreductase

208 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.292 kDa

MTKLLYITAHPLDELGSNSMAAGKTFVDSYKENHPSDEVKHIDLFNEDIPMIDKDVLTGWGKLRNGDELTSEEQQKVNRLSEILDEFLEADKYVFVSPMWNLSFPPVLKAYIDAISIAGKTFKYTAEGPQGLLTDKKVLHIQSRGGYYTEGPAAEVESGDRYLRNIMTFLGVPSYETIIIEGHNAEPEKTEEIKAASIAEAKELAKTF

azoR

FMN-dependent NADH-azoreductase

207 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.853 kDa

MATVLMINASDRLEQGVSVKMYNQFLNSYKEAHPNDTVEELNLFAEKLPYYGNTAITGQYKKAQGVELTGEEKEIVETIERYQEQFLNADKVVFAFPLWNFTVPAPLITYLSYLAQAGKTFRYTETGPVGLVGSKEVALLNARGGVYSNEEMAALEMAANLVRTTMAFWGITQPVEVIIEGHNAAPDQADAIISEGLENVKKAAVAF

azoR

FMN-dependent NADH-azoreductase

207 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.785 kDa

MANILHIDSSPRGDRSISRKLSYEFITSWKDTHPGDTVTYRDLGHNPVPHVDEPWIAAAFSSPESHTPELKTAIELSDTLIDEFLAADRLVFGVPMYNLNIPSTFKAYIDQIVRAGKTFTVDANGYKGLVDSSKKVLIITSRGGSYPPGTPYAAYDYQEPYLRAILGFMGLTDVTFIHAESLNMGEDAREKSLAGAKDAIAQAVANW

azoR

FMN-dependent NADH-azoreductase

206 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.252 kDa

MKILHIDSGILGEHSVSRRLTSAIVSQLKADRPDAEITYRDLASERVPHLTGAQIMAPADLEGVDALLAADVRIGRQMLEEFLAADTVVVGAPMYNFSIPSQLKAWIDRLAVAGKTFRYTEAGPEGLAKGKKLIVASTRGGHYSVAPASAMDHQETYLRSVFGFFGITDIEFIRAEGLNLGPDQKQFAIAEAEKTIAEGNVLKLAS

azoR

FMN-dependent NADH-azoreductase

206 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.101 kDa

MKLLAIDSSILTNTSVSRQLTRSFVSRWQKIYPETEVVYRDLHAQPINHLSQKILAANSVPSTQISAEIREEMNLSMQLISELLSASVLVIGAPMYNFSIPSQLKSWIDRIVIAGKTFKYVDGKVQGLATGKRAYILSSRGGFYNAEPALNLDHQERYLTSILNFIGISDITFIRAEGVNVGEEIRTQSLHQAEAKIQQLLQFQMA

azoR

FMN-dependent NADH-azoreductase

206 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.75 kDa

MTSILLVTSSPRGADSLSTRFATEIAEGLKARFGGALLTRDLAANPPPHITQAYIHGRVTPPEARTPEQVEAVALAQEFVDEVKAADVIVLGSGMINFGPSSQLKAWFDHITWPGVTFGYGEAGRPQGTLTGKKVYLVTAAGGVFSEGDWAPFDFQTGNLRHLLGFVGLTDVEIIRVEGTVFGPEAAKAAIAATEAQVRSILETAA

azoR

FMN-dependent NADH-azoreductase

206 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.635 kDa

MINFLALKSSILGDYSSSSKLIDELLAKYTPQQAIITEHDLAEQPLPVLDGEIAMAMRSPEQLNDKQRDALALSDKLISELVASDLLVIAAPMYNFMIPTQLKNWIDLVARAGKTFSYTEQGPQGLISGTRAIIVTTRGGMHKEQGTDQQVPYLKTVLNFMGISDIEVVYAESLAMGPETAELNLEQARKQLSVFTNDISTLNSQS

azoR

FMN-dependent NADH-azoreductase

206 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.945 kDa

MNILQIDSSVLGDNSVSRSLTASVVADLVAATPDAKVTVRDLDQDAPAHLSGNLLPVLGGPKEGLSAIQEAELQRTEQWLAEFLAADVLVVGVPQYNFSIPSQLKAWIDRIAQAGRTFKYTENGPVGLAGGKRVIVVSSRGGVRQDANELDLHEKTVDIVFRFLGITDITYVRAHGLAMGPQFREAGLASARTEIAALNDASRLAA

azoR

FMN-dependent NADH-azoreductase

205 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.525 kDa

MKLLHIDTSILGAGSVSRELSALIVERLTRGTQAEVTYRDLAAENLPHLTPATLPSAHPLSAMAGPLDATAQAARAASDRMLEEFIGADTVVVGAPMYNFTIPSQLKAWLDRLAVPGKTFRYGANGPEGLVGGKRVIVAVTRGGFYGRESGAVSAEHAESYLRTILAFMGITEPEFVLAEGLAAGDHNKAQALTSARAAVQQLAA

azoR

FMN-dependent NADH-azoreductase

205 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.498 kDa

MSNILLITSSPRGDESVSNKFAGELAGKLKAKSASNTLVHRDLAADPIPHLDTVKTAAIRKPADQRTAEESVAADYSDKLVTELLAADTVVIGTGLINFNIYSGLKSWIDNVARAGQTFKYTETGPVGLATGKKVYIVLAAAGVYSEGPAVSMNHAVPYLKTVLGFMGMTDVEVIYVEGLAFGPEAVEKAVAAAEAKVEELAQAA

azoR

FMN-dependent NADH-azoreductase

205 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.757 kDa

MVNILHIDSSPRAERSHSRELSKEFVSAWRAAHPEDAIAYRDLGHHPVPHVNEAWIAAAFSPPETHTPELAEAIRVSDELVDEFLAADRYVFGVPMYNFNIPSTFKAYIDQIVRINRTVSLDAQGFRGLVEGKKAVIITARGGDFSATSPAVAYDFQEPYLRTIFGFIGITDIQFINANSLNEGDARTQSLAEARAAIQDAIAQW

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.103 kDa

MRVLRVDASARVDDSVTRRLADLMLEILGERVPDLSVVRREAAGMPFVDDAWVGANSTDPEARDSAQRWALAKSDELVSEVMAADVLVIATPIYNFGVPASLKAWVDQVARARLTFRDTEYGPEGLLTGKKAYVLVASGGTEVGSDIDFATPWLEFVLGFLGITDVEVIAADRGMLRGDSARQNAAEHVADVLERDWPALAEAS

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.325 kDa

MKLLHLDSSILGDYSASRQLTASIVAKLQAADPALQYTYRDLAANPIGHLSGAHLAAAQNPPATRTPELANDLALGVQVLQEFLDADTVVIGVALYNFTISTQLKAWIDRVLVAGKTFRYTAEGALEGLAGNKRVILAVARGGRYGEGSPTAALEHAETYMRAALGFVGLHQPEVVVAEGLALGPEARAAGMAAAQAQIDALPV

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.385 kDa

MTKLLQIIASPRGGDSKSNALADAFVAAQRAKDSTLQVDHLDLWAEDLPAFDGDPAAAKMTFFGVGQMDPSKEQAWSAVARITERFMSADHVVMGVPMWNGGIPYRLKHYIDIITQPGMLFGFDPDNGYSGLLRNRKATVVTTSGVWSEGADARFGSDFHSTYLKWWFETIGITDVTFVRYQPSLLTDDPQAGYDRALAALTAA

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.009 kDa

MTRLLVVETSPRGNYSISRNMTRGFVAEWQAAHSDGEVTTRDLMETDLQFIGAPWLQAYFTPSEQHSPEMKAELALSDELVGELLACDHLVVATLVYNYNVPAALKAWIDSIVRKGMTLGFDGKGLVTGKKATVLMASGGVYTEGSPIRDRDIATQYLRLVLGVIGIADVTVVAGGGAKAVDMRETTMEDFIETLQPAIEAAAA

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.896 kDa

MTKILNINSSVRIGDSISRKVTTEFINKWKAREADAIVVERDLAAQPLPHIDGSTLGAFFTPAEQRTPEQAQIATLSETLVRELFDADVIVIGAPMYNFSITSGLKAWIDHVARAGVTFKYTDKGPVGLLTGKKVYIFTASGGVYSEGPAQAMDFNATYLRTVLGFIGLTDVTIINSEGVAMGAEGVNKALAKTSNTINELLPA

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.176 kDa

MKLLHLDASILGTGSVSRELSALIVRRLAGDAPDAVTYRDLVAENPPHLTVATLPGAHPVSAMAGPLDAAGQAVRDASDRMLSEFVAADTVVIGVPMYNFTIPSQLKAWIDRLLVPGTTFRYGAAGPEGLMGGKRVILALARGGFYGPGTASVPAEHAEHYLRTVFGFMGIVPELVLAEGLAAGEHNKAQALASARDAVGQLAA

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.101 kDa

MKLLHIDSSILGDHSVSRQLTAAIIARLQEVTPDLDVSHRDLAANPLSHLSGALLAASAPGAPAPDPSTQAALGESAAILAEFLAADIVVVGAPMYNFAISSQLKAWIDRLVIAGKTFRYADGAVEGLAGGRRLIIASSRGGVFEAGAAAAALDYQETYLRAIFGFIGIADVEIIRAEGLAFGEDARALAIKQAGDAILRLEAA

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.448 kDa

MSSILLLTSSPRADSLSTPIAVDLAEKLKSQNPGSVVVRRDLAANPLPHIDDLFTGAIRKPPEARTAEETVAVKTSDELVNELLAADTIVISTGLINFNIYSSLKTWIDNVARAGLTFKYTESGPVGLATGKKVYVVLASGGVYSQGPAAPLNHAVPYLKSVLGFLGISDIETIYVEGLAFGPEAAEKAIDAAKSRVQEIALAA

azoR

FMN-dependent NADH-azoreductase

204 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.68 kDa

MSSILLLTSSPRAESLSTPIAVELAEKLKNQNPGSFLVRRDLAASPLPHIDDLFTGAIRKPAEARTAEEVAAVKTSDELVNELFAADTIVISTGLINFNIYSSLKTWIDNVARAGLTFKYTESGPVGLLTGKKVYVVLTSGGVYSQGPAAPLNHAVPYLKSVFGFLGITDIETIYVEGLAFGPEAAEKAIDAAKMRVQEIALAA

azoR

FMN-dependent NADH-azoreductase

203 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.732 kDa

MKLLHVDSSILGTYSVSRQLSAEIVAEWRKSRPDTTVEYLDLALNAPNHFGADAIAIKGIAQPEPTEAQRAENALSEQLVSQFLASDVIVIGAPFYNFSIPTQLKAWIDRLAQPGRTFTYNEKGPLGLATGKTVIVASTRGGAYSTSEGGQAMEHQESYLKVVFGFFGITDVRIVRAEGLAMGDAPKAAALSAARADMELATA

azoR

FMN-dependent NADH-azoreductase

203 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.936 kDa

MKLLHVDGSILGPHSVSRTVSAAIVDRLRAQHPGLEVIYRDLAGTPLPHLSGAVLAGAQPNATNTPDVQHDVELGRQVLEEFLAADIVVIGAPLYNFTLSSQLKAWIDRILVAGVTFRYGPTGAEGLAGGKRVIAVVSRGGLYGPGTPAAAAEHAETYLRTVLAFIGITAPEIIVAEGIALGAEARERALAGALDAAAALKAA

azoR

FMN-dependent NADH-azoreductase

203 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.934 kDa

MKLLHVDGSILGPHSVSRTVSAAIVDRLRAQHPGLDVIYRDLAGTPLPHLSGAVLAGAQPNATNTPDVQHDVELGRQVLEEFLAAEIVVIGAPLYNFTLSSQLKAWIDRILVAGVTFRYGPSGAEGLAGGKRVIAVVSRGGLYGPGTPAAAAEHAETYLRTVLAFIGITAPEVIVAEGIALGPEARERALAGALDAAAALKAA

azoR

FMN-dependent NADH-azoreductase

203 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.921 kDa

MKLLHVDGSILGPHSVSRTVSAAIVDRLRAQHPDLDVAYRDLAQTPLPHLSGAVLAGAQPNATNAPDVQHDVDLGRQALDEFLAADVVVIGAPLYNFTLSSQLKAWIDRILVAGVTFRYGPSGAEGLAGGKRVIAVVSRGGLYGPGTPAAAAEHAETYLRTVLAFIGITAPEIIVAEGIALGPEARERALAGALDAAAALKAA

azoR

FMN-dependent NADH-azoreductase

203 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.761 kDa

MKTLVLLSSILGDRSKSKALADHFLARMCEHEPASDITVRDLAAQPVPYFDAETAGALFTPADARSDAQRAIVALSDALIAELQAAERVVFAVPTYNFNLPAQLKSYLDYVARAGITFRYTPEGVPEGLLQGKQVYVLIARGGKALGTPQDSMTPYLKQMLGFLGMQDVTVIAAEGMAMGEFAAAEGLAQAKARIDELLPQLA

azoR

FMN-dependent NADH-azoreductase

203 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.485 kDa

MANLLIVKAHPLDAQKSYALRALEEFQTRYASLHPEDRIEIVDVFEDQIPALDKPLLEAMGAAKRGEAISPEQAEQLGRYNALTQQFLAADKIVVVNPLWNLNVPSQLVSWINTINVAGLTFKYGPEGSIGLVKGKKLLHIQSNGGVYAGQDPAAQYIKSIFEFLGFEDIHQVFIEGQSADPSQSQVIFEEAMAKIDQILESY

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.783 kDa

MKLLHLDSSILADNSVTRELSAVVADTLRQRHANVETSYRDLAANPIAHLSGEIVGARFAPESDWTATQRSEAALSEQLIEEFIAADVLVIGAPMYNFSIPTQLKSWIDRVAAAGRTFKYTENGPVGLVPNKKVVLVSARGGVHSGEQGSLMDFQEDYVVKVLGFLGVSDVEIIRAEAIGMGPDKRATSIHLAKEAIAKLAL

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.042 kDa

MKLLHIDSSVLGPHSVSRQVSAAIVARLREVNPGAAVTYRDLGASPLAHLSGAHLAVAQGAVPAPELQDDLAAGAAVLEEFLAADTVVIGAPMYNFTIPTQLKAWIDRILVAGKTFSYSGGTVQGLAAGKRVIIAISRGGFYGPDTPMAVGEHLESYLRFVFGFIGITEPDIIAADGIKFSPEHREKAIASALSAVTALRAA

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.198 kDa

MKLLHIDSSILGDSSASRHVSAAAVAQFRKKDPSVEVISLDLASDPLPHLDVEALSWLGKDLTPDVSGRPELIAGANALKDFKAADIVVIGVPMYNLSIPSQLKAWIDRIMVAGQTFRYTSGGGIEGLAKGKKVVLAVARGGLYGEGSPAASFEHQLSYLKSVFAMIGITDLTVIEAEGLATNGGADRARILSDAEQKASAL

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.958 kDa

MATVLRIDSSALSNGSHSKALADFFQTQWLEKHPTDSFQTLDLSQTPPPHLSEATIGAMFTPTEERSKEQTQQLALSTDYIEQLKKADVILISTPMYNFGIPSTLKAYLDHSLRVGETFVYTDKGPKGLLEGKKAIVVAASGGDYTQSPLDAMNFVTPYLKTALGFIGIEDVTLVEAPGMAGDEASINKSIKQAKQTLQNCL

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.56 kDa

MKLLHIDSSVLAEHSVSRQLTARIVTEWQATHPGTAVEYLDLAQDTPATLSGAELAARMTPADSRSAEQTAAAARTEAFLQQFLAANVIVVGAPMYNFSIPSQLKNWIDCIAQAGRTFKYTETGPVGLAGNKTVIVASSRGGVYSTSEALRALDHQESYLRTVLGFMGIDNVRIVRAEGVNQGADRRSQALAAAEADIATLV

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.744 kDa

MKIQKVLVIKSSMTENLPSGSFSSALSDKFMEYYRKENPIDKIIELNLNDQKDLISLSSQNFNTFFTDGVSDKYIDQLKSVDKVVISSPMTNFNYTALLKNYLDRILVANKTFSYKYSKKGEAIGLLPHLKVQILTTQGAPLGWYTWGDHTKNLEGTFEFIGAKVAKSVVMDGLKTPQYSSLKAPEALDLFDKVIKTAAENF

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.139 kDa

MTTLLLVHSSARTGGSRTREMADILTAEWHARGDNHQVRVVDLADTPPPHVDAATIRHFFGLAGAEEPATASLALSDTWIEQLLQADALAFAVPMYNFSLPSTLKAWLDHVIRPRRTFRKVADGELEGLAGPKPALVMTASGGLFADTSLDHLRPYMKTALAFMGIDSPRFVDWEGTARADIDPAAQRRTVTAQLREWVHAC

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.323 kDa

MKQILLIDVSPRGKDSASRSVADTLAARLTSLYPSAKLIRRDLAAQPLPHLDEITLRALSTRDAAEAERLKETARQSDQLTDELLESDLLVIATPMWNFGIPSVLKAWIDLVVRPGRTFQYADGEVLGLAKDKKAILVLASGGVFTEGPWRPWDFIEPYLRQILNFIGIVDVQTVRIEGMNIPELVVDAVPKANKAVAELVL

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.678 kDa

MNLLHLDSSILGDHSASRQLTHEVVQAYQRSHADSQVTYRDLASEALGHFSAASLAAAGTPVEARDASQQQEVDTNEATLQQFLAAEVLVIGAPMYNFTIPSQLKAWFDRIMVAGRTFRYSEAGPEGLCGGKKVIIVSTSGGLHVGQPTGAGHEELLKALFAFIGITDLQFVRAHGLAYGEEPRANAMTAAQQHIESELFAA

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.417 kDa

MKNVLVLNASLQGENGNSSQLTSEFVTQLQQTESIKVEKVDLNTLNLPHLSAQEMQTWSMLSDNMTNDQAALAAYSNELLAQLERSDVIVVGMPMYNFTIPSTFKAWIDRVARAGRTFSYTSEGPKGHLQGKTVYIFAARGGIYQGTDNDTQTPYLKLVFGLMGITDVNFIYLEGLNMGEEYAQTSWQQARESLTTLLPATV

azoR

FMN-dependent NADH-azoreductase

202 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.578 kDa

MNLLHLDSSILGDHSASRQLTHEVVQAYLTAHADSQVTYRDLASDALGHFSAASLAAAGTPVEVRDAAQQQEVAGNEATLQQFLDSDVLVIGAPMYNFTIPTQLKAWFDRILIAGRTFRYSEAGPEGLCGGKKVIIVSTSGGLHAGQPTGVGHEELLKALFAFIGITDLQFVRAHGLAYGEEPRASAMSAAQHYIQNELFAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.931 kDa

MAKLLYIKANPKSNQSSRTFIISEHFIKVYKEFHPNDQIITLDLYKEGIHFLSQEDINDIFAPKTEASKHHHILKYAYQFAEADKYVFAAPMWNLGIPAILKAYIDYITVSGITFKYTEQGAVGLLRGKKAVHIMATGGEYKTLPFSDFEMANRYLKTILGFMGVEDFKTITAQRLDIVGEDVEKIMFTALKEAEEIAKGF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.952 kDa

MAKLLYIKANPKSDQSSRTFIISEHFIKVYKEFHPNDQIITLDLYKEGIHFLSQEDINDIFAPKTEASKHHPILKYAYQFLEADKYVFAAPMWNLGIPAILKAYIDYITVSGITFKYTEQGAVGLLRGKKAVHIMATGGEYKTPPFSDFEMANRYLKTILGFMGVEDFQTITAQRLDIVGEDVEKIISNALKEAEEIAKRF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.554 kDa

MSKVLVLKSSILAGYSQSGQLSDYFVEQWREKHPADAITVRDLAANPVPVLDGELVGALRPSDAPLTPRQQDALALSDELIAELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEKGPEGLVTGKRAVILSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQSDAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

23.175 kDa

MAKVLYVKANPKNNEESRTFRISEHFINEYKKAHPEDEIIELDLYKENIHFLSKEEINTIMSKDKSNLKDHPVLKYTYQFAEADKYVIATPMWNLSIPAILKAYFDYITVTGITFKYTENGAVGLLKNKKAVVIMSTGGEYLTPPFDQWNFASTYVTTMFKFFGVEDVSLIAAQRLDIIGEDVEKRVSDAMKEAEQLAKQF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.74 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPVPVLDGELVGALRPSDAPLTPRQQDALSLSDELIAELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEKGPEGLVTGKRAIVLTSRGGIHKDTPTDLVTPYLSLFLGFIGITDVNFVFAEGVAYGPEMATKAQSDAKAAIDALVSA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.42 kDa

MSNVLVIQSSILGSYSQSAKLLDNFAVEWKQKHPTDNIVIRDLAAEPLPVLDGEIIAALGGNGELNERQKAAAELSLNLIEEVKTADYVAIAVPMYNFGIPVQLKTWIDLICRAGVTFSYTENGPQGLLVGKKVLVVTTTGGAHRNTATDLALAHIQAVLSLVGLNDISVAYAETLNMGPEAQERGLAEATKAIQAFIAAH

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.822 kDa

MSKVLVLKSSILATYSQSNQLADFFVEQWKTAHAGDEITVRDLAAQPIPVLDGELVGALRPSDAALTPRQQEALALSDELIAELQANDVIVMAAPMYNFNIPTQLKNYFDLIARAGVTFRYTEKGPEGLITGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVKFVFAEGIAYGPEVATKAQADAKELLTQVVSA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.6 kDa

MSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.6 kDa

MSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.6 kDa

MSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.6 kDa

MSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.6 kDa

MSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.6 kDa

MSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGGIHKDTPTDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.63 kDa

MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGVTFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQSDAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.611 kDa

MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAAPPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.628 kDa

MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.628 kDa

MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.628 kDa

MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.628 kDa

MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.668 kDa

MKLLHLDASILPEDSSVSRTLSAAVVAHVRALQPDLTVTRRDLVAHPLSHMTLANLPPDHPASVPGNEVERAESQAVLEEFLTADIVVIGAPMYNFTIPTQLKSWLDRVLVPGRTFKYGPEGVKGLVEGKRVIVALSRGSFYGQETPYATAEHTETYLRTALGFIGIATPEVIVAEGVSRGEDQRAAAIEAAHQTVAALRV

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.929 kDa

MSKLLVVKGHPLTAEYSLSLKGLDAFVKSYKSAHPEDEIEELDVFSADIPTLNTELVSAMFAGENAELTASQKDKLARFAGFTDQFLSADKVVIANPMYNLMIPAELKSWVDTVNVAGKTFKYTAEGPVGLANGKKVLHLQANGGVYGAQDPATVYMSAIFNFIGSDFRQIAVEGHAYDPEKTEELLAEFIKKVELEAQAF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.982 kDa

MNILVIKSSVNEKKGSYSSHLSDLFIKFYLEIHPEDQIEVYDLNQFGLANTNLTIKNFEDKTFYQKAESDFWINKLRKADKIVFSTSMTNFNYSATTKNFFDAITVPNKTFLLDKNTGKYTGLLKNIQNVQILTAQGAPLGWYPFGNHSALIKQIFEFLGAKVRSDFFVLDGTKVAPNNQKPIADFVAQRQNQIKILAENF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.986 kDa

MNILVIKSSVNEKKGSYSSHLSDLFIKFYLEIHPEDQIEVYDLNQFGLANTNLTMKNFEDKTFYQKAESDFWINKLRNADKIVFSTSMTNFNYSATTKNFFDAITVPNKTFLLDKNTGKYTGLLKNIQNVQILTAQGAPLGWYPFGNHSALIKQIFEFLGAKVRSDFFVLDGTKVAPNNQKPIADFVAQRQNQIKILAENF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.958 kDa

MNILVIKSSVNEKKGSYSSHLSDLFIKFYLEIHPDDQIEVYDLNQFGLANTNLTMKNFEDKTFYQKAESDFWINKLRNADKIVFSTSMTNFNYSATTKNFFDAITVPNKTFLLDKNTGKYTGLLKNIQNVQILTAQGAPLGWYPFGNHSALIKQIFEFLGANVRSDFFVLDGTKVAPNNQKPIADFVAQRQNQIKILAENF

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.78 kDa

MKLLHIDSSIAGVGSVTRELSAEIVALLKGADKSWNVIYRDLVAEPLSHLTGGYLAALQGAPADQAVQADVGAGLAVMEDFLAADVIVIGAPMYNFGVPSQLKAWIDRLAVPGKTFSYGEHGPVGLCKGKKVIVASARGGIFSAGSPLAALDHQENYLLSFFGFLGIAEISFVRAEGVALGPVVRAKAIAAAKEHAAKLAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.901 kDa

MSKVLVLKSSILAGYSQSNQLADHFTTQWQSAHPDDSITVRDLAAQPIPVLDGELVGALRPSDATLTPRQQEALKLSDDLIAELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFRYTEQGPEGLVKGKRAIVLTSRGGIHKGTPTDLLEPYLRVFLGFLGLTDLEFVFAEGYGYGPDVAQKATEDAKTQLSQLVTA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.642 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.646 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTTRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVAA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.658 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.714 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTEKGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVAE

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.744 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLATNPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTEKGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVAE

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.658 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity. The enzyme can reduce ethyl red and methyl red, but is not able to convert sulfonated azo dyes.

Belongs to the azoreductase type 1 family.

21.658 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA

azoR

FMN-dependent NADH-azoreductase

201 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.642 kDa

MSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVAA

azoR

FMN-dependent NADH-azoreductase

200 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.766 kDa

MKTVLAIFSSLNGTEGNSSKLANEYLLKIENDDSVRINRVDVASLALPHLTGEEMQAWMTDASERNESQHALAKISDNIVEAVKAADEIVLAVPMYNFGIPSSLKAYFDRIARAGITFKYTETGPVGLLENKSATVFAARGGVYAGSDFDTQTPYLKHFLNFIGISDVNFVYAEGLNMGEEQANSAFADANEKIIELTKG

azoR

FMN-dependent NADH-azoreductase

200 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.869 kDa

MNILQINSSARSEGANSTRVANDVTTRLLAANPDATVTVRDLAKNPVPVLDEAALGALFAPVESRSTDQAARVAASDALIAEVQAADVLVLGVPMYNFTVTAQFKNWIDAIARAGVTFRYTANGPEGLLKGKTVYVALARGGQYRGSPLDTQVPYLKAVLGFLGITDVRFIYAEGLNMGPEAAAKGFAQAAADLDAALAA

azoR

FMN-dependent NADH-azoreductase

200 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.112 kDa

MSKVLVLKSSIMAQHSHTNQMADFFIEKWQTNHADDSITVRDLTAQSIPALDNELVHALRPSGNEMTARQKETLALSDELIAELQDNDVIVITAPMYNFHIPTQLKSYFDMIARAGVTFRYTENGPEGLLKGKQVIILTSRGGIHKDGPSDLLVPYLRLFLSFIGLTDIEFVFTEGVALGPDAANQAQQTAREVLQAIAS

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.97 kDa

MATLLQIKSSLFGDNGNSSQLANEFVERWKTQNPNGEVVIRDFAKEDVPHLDATRVQALFTPAEQRTAEQQAVVEYSDKIIAEIQAADAIVLGVPLYNFGIPSTLKAYFDHIARAGVTFKYTETGPVGLLTDKPVYILAARGGIYKGQPSDTQSRYLVDFLNFVGLKDIHFIYAEGLNMGQKDQAFASAKHEIEQEIAA

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.231 kDa

MSKVLVLKTTAQADEVSNSVALTNRFLEEYKKFNPDDEIIIVDLNKDEVGTSILTSETFPTFYQQEVTKKYINLLKSVDKLVIACPMYNFSTPVTLKSFIDHVSVANETFSYKYSKKGDAIGLITNLKAQILGVQGAPLGWYPWGQHTQYVEGAMRFLGIEFNKTVLLAGVKVAPLLELTPAQRVETIIDEVIQAAKTF

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.261 kDa

MSKVLVLKTTAQADEVSNSVALTNRFLEEYKKFNPDDEIIIVDLNKDEVGTSILTSETSSTFYQQEVTKKYINLLKSVDKLVIACPMYNFSTPVTLKSFIDHVSVANETFSYKYSKKGDVIGLITNLKAQILGVQGAPLGWYPWGQHTQYVEGAMRFLGIDFNKTVLLAGVKVAPLLQLTPEQRVETIIDEVIEAARTF

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.427 kDa

MNILQINSSARSDASNSTRVANSIVERLRASHPGAAVVVRSLAQNPHPVLDEAALGALFTPADKRTPEQTARVALDDVLIAEIQAADAVVIGVPMYNFGVPVQLKNWIDAITRVKVTFRYTANGPEGLLKDKKVYVAFARGGRYRDTPADTQVPYLKTIFGFLGMTDVHFVFAEGLAMGADAAEQAFAEAERDIEAALA

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.637 kDa

MSRVLVIESSARQEGSVSRQLTAEFLARWKAAHPNDEIVVRDLANEPVPHLDIDLLGGWTKPAEQQSEAEKAALARSERLTGELLGADVLVLAAPMYNFAIPSTLKAWLDHVLRAGVTFKYTENGPQGLLSGKRAFVLTARGGIYAGSPLDHQEPYLRQALGFIGIHDVSFIHAEGLNMGGDFQQKGLARAKEKLAQVA

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.688 kDa

MAKVLVLSGGLSEKEKSYSSQMLDLFVKTYKEVHPNDELEFVDLNTTKHAEVFLSRNTFATYWKDVESDKWIDKLKAADKVILSCSMTNFGPTAVVKNFIDSVAVANKTFSYKYSKKGDAVGLLDHLRVMIVTTQGAPKDWYLWGSHTNWLIGTWKFLGAKYVDTFELNGTKLSVFADKKPYDVVEEFRQDALEKAKQF

azoR

FMN-dependent NADH-azoreductase

199 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.191 kDa

MKILQINASARSAGANSTRLADTVTARLLARNPNAVVELRDLASHPHPVLDEPALGALFTPADQRTAEQSARVALDDALIAQVQSVDAIVLGVPMYNFGVPVQLKTWIDAIARAGVTFHYTEKGPEGLLKGKKVYVALARGGLYRDTPADSQVPYLKSVLGFLGMTDVEFIYAEGLAMGAESASKAFAEAEAQIEELIA

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.927 kDa

MTTILQINSAARSQGAQSTLLANELTAKLQQSNAGAKVVVRDLLADGLPHLDESVLGAFFTPADQRSAEQNAIVAKSDALIAELQAADIIVIGAPMYNFGVSSQLKTYFDWIARAGVTFRYTENGPEGLIKGKKVYVVTARGGKYLGTPNDSHTPYLRTFLGFIGLTDVSFIHAEGLNLGPDSQSAALASAREAIAAA

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.862 kDa

MTTILQINSAARSQGAQSTLLADELTAKLQQGNPGATVKVRNLLADALPHLDDAVLGAFFTPADQRSAEQNAIVAKSDELVDELRSADVIVIGAPMYNFGVSSQLKAYFDWIARAGVTFRYTSEGPEGLIKGKKAYVVSARGGKHVGMPTDSQTPFLKTFLGFIGLTDVTFVYAEGLALGPDAATEALASAREAIAAV

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.862 kDa

MTTILQINSAARSQGAQSTLLADELTAKLQQGNPGATVKVRNLLADALPHLDDAVLGAFFTPADQRSAEQNAIVAKSDELVDELRSADVIVIGAPMYNFGVSSQLKAYFDWIARAGVTFRYTSEGPEGLIKGKKAYVVSARGGKHVGMPTDSQTPFLKTFLGFIGLTDVTFVYAEGLALGPDAATEALASAREAIAAV

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.862 kDa

MTTILQINSAARSQGAQSTLLADELTAKLQQGNPGATVKVRNLLADALPHLDDAVLGAFFTPADQRSAEQNAIVAKSDELVDELRSADVIVIGAPMYNFGVSSQLKAYFDWIARAGVTFRYTSEGPEGLIKGKKAYVVSARGGKHVGMPTDSQTPFLKTFLGFIGLTDVTFVYAEGLALGPDAATEALASAREAIAAV

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.841 kDa

MTTILQINSAARSQGAQSTMLADELTAKLQQGNPGATVKVRSLLADALPHLDDAVLGAFFTPAEQRSAEQNAIVAKSDALIDELRSADVIVIGAPMYNFGVSSQLKTYFDWIARAGVTFRYTAQGPEGLLKGKKVYVVSARGGKHVGMPTDSQTPFLTTFLGFIGMTDVTFVYAEGLALGPDAASEALASAREAIAAV

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.344 kDa

MNKVLYIKANAKPEGKSRTFKISDVFIDEYKQNNPDDEIITLDLYKEDIDFLRSKDLDTVFGPKNEESKNHPTLKYAYQFAEADKYVIAAPMWNLSIPAILKAYVDYISVVGIAFKYTQEGAVGLLENKKAVYIAARGGSYAETPYELDGIYLRSILGFFGIKDITTISAEKLDVQGENVDKILEEAIDKAKETAKNF

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.366 kDa

MSKVLYIKANIKNEGESRTFKVSDSFVEEYKKNNPEDEIITLDLYKENIDFLRADDLGKLFGPKDEESKNNSILKYAYQFADADKYIIAAPMWNLSFPAILKAYIDYVSVSGITFKYTAEGPVGLLNNKKAVHIVSRGGGYDNSPYEMGDRYLRTILGFFGIKDIETIAIDNLDVMGVNVEEKVEEGIEKAISLAKKF

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.39 kDa

MSKVLYIKANIKNEGESRTFKVSDSFVEEYKKNNPEDQIITLDLYKENIDFLRADDLGKLFGPKDEESKNNSILKYAYQFADADKYIIAAPMWNLSFPAILKAYIDYVSVSGITFKYTAEGPVGLLNNKKAVHIVSRGGGYDNSPYEMGDRYLRTILGFFGIKDIETIDIDNLDVIGVNVKEKVKEGIEKAISLAKKF

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.099 kDa

MSKVLILKSSILGGYSQSAVLIDHLASHWETQGAAITVRDLGGKDVLPMVDGEIASGLRGGAELSARQQEMLALSDTLVSELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETGPKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLGFIGITNVEVVYAEALNMGPEAHDKGMSEAKHSIDQLKA

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.127 kDa

MSKVLILKSSILGGYSQSAVLIDHLASHWETQGAAITVRDLGGKDVLPMVDGEIASGLRGGAELSARQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPTQLKNWIDFIARAGVTFTYTETGPKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLGFIGITNVEVVYAEALNMGPEAHDKGMSEAKHSIEQLKA

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.111 kDa

MSKVLILKSSILGGYSQSAVLIDHLASHWETQGAAITVRDLGGKDVLPMVDGEIASGLRGGAELSVRQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETGPKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLGFIGITNVEVVYAEALNMGPEAHDKGMSEAKHSIDQLKA

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.083 kDa

MSKVLILKSSILGGYSQSAVLIDHLASHWETQGAAITVRDLGGKDVLPMVDGEIASGLRGGAELSARQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPAQLKNWIDFIARAGVTFTYTETGPKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLGFIGITNVEVVYAEALNMGPEAHDKGMSEAKHSIDQLKA

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.294 kDa

MSKVLYIKANIKLEGVSRTFQVSDHFIEEYKKQHPEDEVVVLDLYKENIDFLRPEDLEAMADINDETKKNTTFLKYAFQFAEADKYVIAAPMWNLGSPAILKAYFDYITITGITFHYTAEGPKGLLQNKKAVHIVARGGEYGNAPYEMGDRYVKTILGFLGVSDIQTIAIENLDIIGADVEAKVKEGKEKAGLVAKEF

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.367 kDa

MNILVIKSSVFGDNGNSSALVNAQVDALKAKHPQATVRVRDLSTDPIPHLDGNRVSAFFTSATQRTDEQQAIDAFSLALIDEIKAADHIVLGLPMYNFGIPSQLKSWIDHVARAGITFRYTEKGPQGLLENKPVTVLAARGGIYAGTSNDTVTPYIKLFFGFIGITDVEFVFAEGLNMGDDVKEKALAVARSELLAST

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.673 kDa

MAKVLVIKTSMMGANSISNVLNDKFMEYYKEKNPNDEFIYMNLNDEKMASITMTSHNMKEYFVAEYSDKYINQLKKVDKVVMSVPMTNFNVNAVTKNYLDHISVADKTFSYKYSKKGEAIGLLDHLSVQILTTQGAPLGWYPWGNHSEYLKGHWRFLGAKVADHILVDSVKIGENSKKTPQEIIEKFDGEIKKAAYSF

azoR

FMN-dependent NADH-azoreductase

198 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.682 kDa

MTTILQINSSARSQGAQSTLLANELTAKLQQSNPGAQVVVRNLHEDALPHLDDAILGAFFTPAEQRTAEQQAIAARSEALIAELQAADIVVIGAPLYNFGISSQLKTYFDFIARAGITFKYGANGPEGLVKGKKVFVVSARGGKYAGTPGDSQTPYLTTFLGFLGMTDVSFIYAEGLNMGPDAASAALAGAREAIAAA

azoR

FMN-dependent NADH-azoreductase

197 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.012 kDa

MATLLRIDSSASGENSKSRQLANEFVEKWLAKNPEGKVVARDVTANPLPHFTGETLGALFTPEENRTAEQQAIVAIGDELIAELEAADLVIVSAPMYNFGIPSTLKSYFDHVARAGRTFKYTETGPVGLVNKDAYIFAASGSFLAGAPVDHQVPHIQTFLGFIGLNVKDTFIAGGQAMGEPGEDAFNQAKSQIAVAV

azoR

FMN-dependent NADH-azoreductase

197 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.08 kDa

MSKVLFINASPVANEASFSYQLAKTFESEYLKLNPSDQVSWLDLNELDKGSMTLTSKNSKEHFKDENVDPLINQIKSVDKLVVIAPMTNFNYPATLKNWLDKICVANKTFSYKYSKKGGSIGLMDHLKVMIINTQGAPEGWYAFADVTVLLKGVFEFIGAMVDSIKVAGTKVEYLNKQPKEIVEPNLALIKEKAKNF

azoR

FMN-dependent NADH-azoreductase

197 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.189 kDa

MKKVIIVDASVTPSGSYTHLLLDRFLQTYKKQNSSVEFIDWNLNELPVGKISYNTQNASNFFSFENSDYYIDALKTAYGIVILAPMTNFNYPASLKNFIDHVFVANKTFQDKYVTKGASKGLLTNLKVVVLASQGAPLGWYPWADHVSNLKGLFGFAGVTHFESVLIDDTKILYKDKNKQEVVDLFAHKVDQVANNF

azoR

FMN-dependent NADH-azoreductase

197 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.55 kDa

MKKVIIIDASVSPSGSYTHLLLERFLATFQAKNKDVELSTWNLNELPVGQISYNTQNAGTFFSVENSDKYIDALKAAHGVIILAPMTNFNYPATLKNFIDHVFVANKTFKDKYVTKGASSGMLGNLKVVVLGSQGAPLGWYPWGDHVNSLRGLFGFAGVASFASVIIDGTKLLYKDKSKSEVVDMFAKQVDAIANEF

azoR

FMN-dependent NADH-azoreductase

197 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.997 kDa

MSTILHITASIRGDESISRALSSKLVERLSGTDTKVITRDLSQNDIPYVDADRFAANLSPYTERSPEQQELAAIADTLIEELQAADTIVLGVPIYNFSVPATVKAWADTVARAGTTFEYTPTGPKGKLDGKKAYITVASGGTPVGSEVDFMSPWLKFFLGFLGISEVEVVATADGIMGEGGEEKIASAHKQVEQVAA

azoR

FMN-dependent NADH-azoreductase

196 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.001 kDa

MTTILRIDSSIKGEAAVSRRLTQRILDRLLEAHPDATVVSRDLAQGIRQIDGPWLGSVFTAPEQRTADQQEIARTADAVMAEVKEADILVIALPVYNFGAPAQLKSWVDHIARRGESFVYTETGPVGLLTGKRAIVAFTSDGTPLGSELDHASGWLRQVLGFVGITDVDFVAADRMVFGADEAMARAEAAVAALAA

azoR

FMN-dependent NADH-azoreductase

196 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.943 kDa

MTTILRIDSSIKGEAAVSRRLTQRILDRLLEAHPDATVVSRDLAQGIRQIDGPWLGSVFTAPEQRTADQQEIARTAGAVMAEVKEADILVIALPVYNFGAPAQLKSWVDHIARRGESFVYTETGPVGLLTGKRAIVAFTSDGTPLGSELDHASGWLRQVLGFVGITDVDFVAADRMVFGADEAMARAEAAVAALAA

azoR

FMN-dependent NADH-azoreductase

196 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.991 kDa

MTTILRIDSSIKGEAAVSRRLTQRILDRLLEAHPDATVVSRDLAQGIRQIDGSWLGSVFTAPEQRTADQQEIARTADAVMAEVKEADILVIALPVYNFGAPAQLKSWVDHIARRGESFVYTETGPVGLLTGKRAIVAFTSDGTPLGSELDHASGWLRQVLGFVGITDVDFVAADRMVFGADEAMARAEAAVAALAA

azoR

FMN-dependent NADH-azoreductase

196 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.769 kDa

MSKVLVLKSSILGDFSQSGRLIDEWVAARRASGDTVTVRDLAAEPLPVLDGEIASGLRGGESLSPRQQEALALSDALIAELKVHDQLVVAAPMYNFSIPTQLKNWIDLVARAGVTFTYTAEGPQGLIQGKQAMLITTRGGVHKGSGSDHVVPYLKTVLGFIGITDVDTVYAEALSMGPEAAERGIKDARDQLALVG

azoR

FMN-dependent NADH-azoreductase

196 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.101 kDa

MKKVLVLLSSPVAKENSYSTYFATKFVEEYQKINQEDEIKIIDLNSFDVSQKTLTSGNFATFFNENDSDALINELKSVDKLIVASPMINFNVPATLKNYLDHICVANKTFSYKYKAKGASIGLLDHLKVQIITSQGAPSGWYSFSSHTKYLEGLFNFLGIEIAPSIEITGTKVDPKPKEELYLEFEQEIIKKASEF

azoR

FMN-dependent NADH-azoreductase

195 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.175 kDa

MSRLLVLKSSILGDYSQSNKLVDEFINHFDHQQLVVRDLAQQPLPVLDFQVATALRAAGELTAEQQAIVTLSDTLIDEIKEADTLVIAAPMYNFTIPTQLKNWIDLIARAGVTFTYTEQGPKGLIEGKKAVIVTTRGGIHKDAASDIITPYLKTVLGFVGITEVEFVYAEALNMGDDFANKGLASASEHLAALTA

azoR

FMN-dependent NADH-azoreductase

195 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.108 kDa

MSRLLVLKSSILGDYSQSNKLVDEFINHFDQQQIVVRDLAQQPLPVLDFQVATALRAAGELTAEQQAIVTLSDTLIDEIKAADTLVIAAPMYNFTIPTQLKNWIDLIARAGVTFTYTEQGPKGLIEGKKAVIVTTRGGIHKDAASDIITPYLKTVLGFVGITEVEFVYAEALNMGDDFANKGLASASEHLAALTA

azoR

FMN-dependent NADH-azoreductase

195 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.821 kDa

MANILVLKSSILGQYSQSNALIDGFLADHQSDTVTVRDLATLNLPVLDGELASGLRGGDNLNERQLAVMAQSDELIAELKGSDLVVIAAPMYNFSIPTQLKNWIDLIARAGVTFRYTETGPVGLVENTRALVISPRGGMHVGSATDLVTPYMRTVLGFIGIKDVDFIYAEGMGMGPDAQAKGIEQAKGQLETLAL

azoR

FMN-dependent NADH-azoreductase

195 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

22.052 kDa

MRKILHIRSSIKEENSVSRKIGDDLISHFKSTDKVKVSERDLVDNSVEHINPDFINAMANNNQDRLATSNKLIEELFENDIIAIESPMYNFSIPSTLKSWIDNIMIARKTFLYTANGPEGLVKNKKAILVLSKGNIYSEGAAKPLDFQENYLKTILNFIGINDITVICAEGVDLNAEIREKSLKQVEQQIKNLSI

azoR

FMN-dependent NADH-azoreductase

195 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.948 kDa

MKLLHLDASVLGDNSVSRQLSAAVVARFTGQIDGLQVDYRDLDANPVPHLRSSSLARTDAAEATDAEQVMQQFLDADIVVIGAPMYNFSIPSTLKAWIDRVAVAGRTFKYTENGPVGLASGKRVIIASSRGGIYTDSPADFQEPFLRQVFAFMGINEVEFVRAEGIAYSPQHREDAIAGALAALPSHEVVEAVAA

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.979 kDa

MSRVLALKSSILGDYSQSNKLVEDFIKNVDQDKLTVRDLAANPLPVLDFAVATALRATEDLSQEQQAVVDLSDTLIEEVKAADTLVIAAPMYNFTIPTQLKNWIDLIARAGVTFKYTENGVQGLIEGKKAIVVTTRGGIHKDSPTDNVTPYLRTVLGFVGITDVEFIYAEALNMGEDAASKGISDAQSQLATMA

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.78 kDa

MKLLHLDSSALGATSISRELSAAIVAQQRRLYPEVEVTYRDLDRDPIPHLTAQTLAQTDPAEAAAAEAVMQQFLQAEVIVIGAPMYNFAIPSTLKAWIDRIAVAGRTFHYTANGPEGLAGGKRLIIASARGGVYAEPSNDFQEPYLRQLFGFLGIDDITLVRAEGVAYSPQHRADALAAALAGLCAEQDAAVMA

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

20.833 kDa

MKLLHLDSSALGATSISRELSAAIVAQQRRLYPEVEVTYRDLDRDPIPHLTAQTLAQTDPAEAAAAEAVMQQFLQAEVIVIGAPMYNFAIPSTLKAWIDRIAVAGRTFHYTANGPEGLAGGKRLIIASARGGVYAEPSNDFQEPYLRQLFGFLGIDDITLVRAEGVAYSPQHRADALAAALAGLRAEQDAAVMA

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.194 kDa

MSNVLVLKSSISGNNSQTNQLADYVIEKLQGNNIVVRDLSQQPLPYFDTAAAIAVRGEPKTTEEKQLLALSDKLIEELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPRVTFQYTANGSEGLLKGKKAIVLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGFGPEAIEKAQASAKNKINEIVAAL

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.312 kDa

MNNVLVLKSSISGNNSQTNQLADYVIEKLQGNHIVVRDLAQQPLPYFDTVAAIAVRGEPKTTEEKQLLALSDELIEELKNAQTLIIGAPMYNLNIPTQLKSYFDFIARPRVTFQYTAKGPEGLLKGKKAIVLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGLGAEAIEKAQSSAKNKINELITSL

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.232 kDa

MSNVLVLKSSISGNNSQTNQLVDYAVEKLQGNNIIVRDLSQQPLPYFDTVAAIAVRGEPKTIEEKQLLALSDELIEELKNAQTLIIGAPMYNLNIPTQLKSYFDFIARPSVTFQYTAKGPEGLLKGKKVIVLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGFGPEAIEKAQASAKNKINEIVAAL

azoR

FMN-dependent NADH-azoreductase

194 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.208 kDa

MSNVLVLKSSISGNNSQTNQLADYVIEKLQGNNIVVRDLSQQPLPYFDTAAAIAVRGEPKTTEEKQLLALSDKLIEELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPRVTFQYTANGSEGLLKGKKAILLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGFGPEAIEKAQASAKNKINEIVAAL

azoR

FMN-dependent NADH-azoreductase

193 amino acids

Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its activity.

Belongs to the azoreductase type 1 family.

21.846 kDa

MKIYQIDSSARKEGSSSRALAKKLLNKIKKPGDEVIYRDLDDDMLFVSGLTESGMKIAEKDQTEEHKKMFELSDKLVSELKESDIIIISAPIYNYGPPATLKAWCDLAARIGETFKFKPNGRREGLLKNKQAYLVITSGGTKLNSSEDFLTPWLKFILNFFGIEKVEVISADQMALDYEKSIKEAEKQIENII