axeA

Acetylxylan esterase A

382 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone.

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

40.273 kDa

MKSLSFSFLVTLFLYLTLSSARTLGKDVNKRVTAGSLQQVTGFGDNASGTLMYIYVPKNLATNPGIVVAIHYCTGTAQAYYTGSPYAQLAEQYGFIVIYPQSPYSGTCWDVSSQAALTHNGGGDSNSIANMVTWTISQYNANTAKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVGAGCFYSSSNQADAWNSSCATGSVISTPAVWGGIAKNMYSGYSGSRPRMQIYHGSADTTLYPQNYYETCKQWAGVFGYNYDSPQSTLANTPDANYQTTNWGPNLQGIYATGVGHTVPIHGAKDMEWFGFSGSGSSSTTTASATKTSTTSTTSTKTTSSTSSTTTSSTGVAAHWGQCGGSGWTGPTVCESGYTCTYSNAWYSQCL

axeA

Probable acetylxylan esterase A

371 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

39.252 kDa

MRALSVFVALFSFLALSSASPGQDVAKRVTSGSLQQVTNFGSNPSGTLMYIYVPNNLATKPGIVVAIHYCTGTAQAYYTGSPYAQLAEKYGFIVIYPQSPYSGTCWDVSSQSALTHNGGGDSNSIANMVTWTISQYNADTSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVPAGCFYSSSNQVNGWNSSCAQGNVISTPEVWGGIAKAMYPGYTGPRPRMQIYHGSVDTTLYPQNYYETCKQWAGVFGYNYNSPQSTQSNTPQANYQTTIWGPNLQGIFATGVGHTVPIHGEQDMEWFGFTGGSSSTTTTATTPPTTSTTTSSGGSSTSTGVAEHWGQCGGNGWTGPTACASGYTCTVINEWYSQCL

axeA

Probable acetylxylan esterase A

368 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

38.975 kDa

MRALSVFFALFCFLALSSASPGQDVVKRVTSGSLQQVTNFGSNPSGTLMYIYVPKNLATKPGIVVAIHYCTGTAQAYYTGSPYAQLAEQYGFIVIYPQSPYSGTCWDVSSQSALTHNGGGDSNSIANMVTWTISQYNADTSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCFYSSSNQVDAWNSSCAQGNVISTPEVWGGIAKAMYPGYTGPRPRMQIYHGSTDTTLYPQNYYETCKQWAGVFGYNYNSPQSTQSNTPQANYQTTIWGPNLQGIFATGVGHTVPIHGEQDMEWFGFAGGSSTTTTQPTTTSTTTSSGGSSTGTGVAAHWGQCGGNGWTGPTVCASGYTCTVVNAWYSQCL

axeA

Cephalosporin-C deacetylase

325 amino acids

Esterase that removes acetyl groups from a number of O-acetylated small substrates, such as acetylated xylose, short xylo-oligosaccharides and cephalosporin C. Has no activity towards polymeric acetylated xylan, 4-methylumbelliferyl acetate or alpha-naphthyl acetate. Able to catalyze rapid hydrolysis of a range of substrates preferably with acetate groups, independent of the alcohol moiety. Exhibits a narrow selectivity for short chain acyl esters (C2-C3). Displays broad substrate specificity by hydrolyzing acetate at 2, 3, and 4 positions of 4-nitrophenyl-beta-D-xylopyranoside (pNP-Xyl) with similar efficiency. Cannot cleave amide linkages.

Belongs to the carbohydrate esterase 7 family.

37.156 kDa

MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFEKG

axeA

Probable acetylxylan esterase A

311 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

33.537 kDa

MAPFSFILTVLLYALTCSARALGHAHALLPRAGSLEQVTDFGDNPTNVGMYIYVPNNLASSPGIVVAIHYSPEGTGTAEAYYTGSPYAQLAEQYGFIVIYPQSPYEGTCWDVSSQETLTHNGGGNSNSIANMVTWAISKYNADSSKVFVTGSSSGAMMTHQNVMAATYPELFAAATVYSGVPAGCFYSSSNQQDGWNSTCAQGQVITTPENWANVAKGMYPGYNGTRPKMQIYHGSVDTTLLPQNYYETCKQWAGVFGYNYDSPQQVQDNTPQSNYATTTWGDDLQGIFATGVGHTVPIRGDDDMAWFGFA

axeA

Probable acetylxylan esterase A

308 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

33.365 kDa

MAPFSFLLTLLLYTLSAGASVLESRSSALLPRAGSLQQVTNFGDNPTNVGMYIYVPNNLASNPGIIVAIHYCTGTAEAYYNGSPYAKLAEKHGFIVIYPESPYQGKCWDVSSRASLTHNGGGNSNSIANMVKWTIKKYKTNTSKVFVTGSSSGAMMTNVMAATYPDMFAAGVVYSGVAAGCFMSNTNQQAAWNSTCAHGKSIATPEAWAHVAKAMYPGYDGPRPRMQIYHGSADTTLYPQNYQETCKEWAGVFGYDYNAPRSVENNKPQANYKTTTWGKELQGIYATGVGHTVPINGDRDMAWFGFAK

axeA

Probable acetylxylan esterase A

307 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

33.286 kDa

MILLSYLLTYLLCALTCSARAIHNGRSLIPRAGSLEQVTDFGDNPSNVKMYIYVPTNLASNPGIIVAIHYCTGTAQAYYQGSPYAQLAETHGFIVIYPESPYEGTCWDVSSQATLTHNGGGNSNSIANMVTWTTKQYNADSSKVFVTGTSSGAMMTNVMAATYPNLFAAGVAYAGVPAGCFLSTADQPDAWNSTCAQGQSITTPEHWASIAEAMYPDYSGSRPKMQIYHGNVDTTLYPQNYEETCKQWAGVFGYNYDAPESTESNTPEANWSRTTWGPNLQGILAGGVGHNIQIHGDEDMKWFGFTN

axeA

Probable acetylxylan esterase A

307 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

33.301 kDa

MILLSYLLTYLLCALTCSARAIHNGRSLIPRAGSLEQVTDFGDNPSNVKMYIYVPTNLASNPGIIVAIHYCTGTAQAYYQGSPYAQLAETHGFIVIYPESPYEGTCWDVSSQATLTHNGGGNSNSIANMVTWTTKQYNADSSKVFVTGTSSGAMMTNVMAATYPDLFAAGIAYAGVPAGCFLSTADQPDAWNSTCAQGQSITTPEHWASIAEAMYPDYSGSRPKMQIYHGNVDTTLYPQNYEETCKQWAGVFGYNYDAPESTESNTPEANWSRTTWGPNLQGILAGGVGHNIQIHGDEDMKWFGFTN

axeA

Acetylxylan esterase A

307 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone. Displays the greatest hydrolytic activity toward alpha-naphthylacetate (C2), lower activity toward alpha-naphthylpropionate (C3) and no detectable activity toward acyl-chain substrates containing four or more carbon atoms.

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

33.286 kDa

MILLSYLLTYLLCALTCSARAIHNGRSLIPRAGSLEQVTDFGDNPSNVKMYIYVPTNLASNPGIIVAIHYCTGTAQAYYQGSPYAQLAETHGFIVIYPESPYEGTCWDVSSQATLTHNGGGNSNSIANMVTWTTKQYNADSSKVFVTGTSSGAMMTNVMAATYPNLFAAGVAYAGVPAGCFLSTADQPDAWNSTCAQGQSITTPEHWASIAEAMYPDYSGSRPKMQIYHGNVDTTLYPQNYEETCKQWAGVFGYNYDAPESTESNTPEANWSRTTWGPNLQGILAGGVGHNIQIHGDEDMKWFGFTN

axeA

Acetylxylan esterase A

304 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone.

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

33.302 kDa

MVKLQYLLSILLYAYSCTALMLDRRDPTPGQLSQVTDFGDNPTNVGFYIYVPQNLASNPAIIVAIHYCTGTAQAYYSGTPYAQYAETYGFIVIYPESPYSGTCWDVSSQSTLTHNGGGNSNSIANMVDWTINQYNADASRVYVTGTSSGAMMTNVMAATYPNLFAAGIAYAGVPAGCFYSEANVEDQWNSTCAQGQSISTPEHWAQIAQAMYSGYEGSRPKMQIYHGSADATLYPQNYYETCKQWAGVFGYNYDSPQEVQNDTPVAGWAKTIWGENLQGILADGVGHNIQIQGEEDLKWFGFTS

axeA

Acetylxylan esterase A

304 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone.

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

32.729 kDa

MLLSTHLLFVITTLVTSLLHPIDGHAVKRSGSLQQVTDFGDNPTNVGMYIYVPNNLASNPGIVVAIHYCTGTGPGYYGDSPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNSNSIANMVTWTISKYGADSSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCFYSNTNQVDGWNSTCAQGDVITTPEHWASIAEAMYSGYSGSRPRMQIYHGSIDTTLYPQNYYETCKQWAGVFGYDYSAPEKTEANTPQTNYETTIWGDSLQGIFATGVGHTVPIHGDKDMEWFGFA

axeA

Acetylxylan esterase A

303 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone.

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

32.591 kDa

MLSTHLLFLATTLLTSLFHPIAAHVAKRSGSLQQITDFGDNPTGVGMYIYVPNNLASNPGIVVAIHYCTGTGPGYYSNSPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNSNSIANMVTWTISEYGADSKKVYVTGSSSGAMMTNVMAATYPELFAAGTVYSGVSAGCFYSDTNQVDGWNSTCAQGDVITTPEHWASIAEAMYPGYSGSRPKMQIYHGSVDTTLYPQNYYETCKQWAGVFGYDYSAPESTEANTPQTNYETTIWGDNLQGIFATGVGHTVPIHGDKDMEWFGFA

axeA

Probable acetylxylan esterase A

303 amino acids

Acetylxylan esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Degrades acetylated xylans by cleaving acetyl side groups from the hetero-xylan backbone (By similarity).

Belongs to the carbohydrate esterase 1 (CE1) family. AxeA subfamily.

32.625 kDa

MLSTHLLFLATTLLTSLFHPIAAHVAKRSGSLQQITDFGDNPTGVGMYIYVPNNLASNPGIVVAIHYCTGTGPGYYSNSFYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNSNSIANMVTWTISEYGADSKKVFVTGSSSGAMMTNVMAATYPELFAAGTVYSGVSAGCFYSDTNQVDGWNSTCAQGDVITTPEHWASIAEAMYPGYSGSRPKMQIYHGSVDTTLYPQNYYETCKQWAGVFGYDYSAPESTEANTPQTNYETTIWGDNLQGIFATGVGHTVPIHGDKDMEWFGFA