About Products Protein Database Contact

ausG

Gene
ausG
Protein
Cytochrome P450 monooxygenase ausG
Organism
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Length
529 amino acids
Function
Cytochrome P450 monooxygenase; part of the gene cluster B that mediates the biosynthesis of austinol and dehydroaustinol, two fungal meroterpenoids (PubMed:22329759). The first step of the pathway is the synthesis of 3,5-dimethylorsellinic acid by the polyketide synthase ausA (PubMed:22329759). 3,5-dimethylorsellinic acid is then prenylated by the polyprenyl transferase ausN (PubMed:22329759). Further epoxidation by the FAD-dependent monooxygenase ausM and cyclization by the probable terpene cyclase ausL lead to the formation of protoaustinoid A (PubMed:22329759). Protoaustinoid A is then oxidized to spiro-lactone preaustinoid A3 by the combined action of the FAD-binding monooxygenases ausB and ausC, and the dioxygenase ausE (PubMed:22329759, PubMed:23865690). Acid-catalyzed keto-rearrangement and ring contraction of the tetraketide portion of preaustinoid A3 by ausJ lead to the formation of preaustinoid A4 (PubMed:22329759). The aldo-keto reductase ausK, with the help of ausH, is involved in the next step by transforming preaustinoid A4 into isoaustinone which is in turn hydroxylated by the P450 monooxygenase ausI to form austinolide (PubMed:22329759). Finally, the cytochrome P450 monooxygenase ausG modifies austinolide to austinol (PubMed:22329759). Austinol can be further modified to dehydroaustinol which forms a diffusible complex with diorcinol that initiates conidiation (PubMed:22234162, PubMed:22329759). AusG may also be responsible for the production of 11-beta-hydroxylisoaustinone using isoaustinone as a substrate (PubMed:22329759).
Similarity
Belongs to the cytochrome P450 family.
Mass
59.273 kDa
Sequence
MAMGNPELRTHFFRSSHEPGIPNSLRFPNGFLVTCGLPWLLLLFSVTIILFHPLRKKSDLPLINPGKGRIGILRGYRSRKTFTTELPRLVADGLSKASAFRIAAPDGVNIVLAPSYAHEIAEHPDLNPGPIAGDEFNSHINGFEVFAQLGTSDVISESVRTRLTRQLTKLTPLLTSETPLLLQSQWKDAPDWVEVSPHETALFILSRLSSLVFVGDDLGRNPDWIRILTSYNTEAFAAAEELNLWPQILRPLIARLKPSCRQLRRYIRDARALLVPVLEQRRHAQSQGDRREYNDAIEWLDETSRSTGQPYDPILSQMLLAIGSFHTSSDLLGQVLLDLCMRPDWKVLVRELRKEIISSLQGEGWDKIALNNLKLMDSVLKESQRLKPASTVTMGRYASREITLSDGTIIPKGSTVFIANVAMRDSNIYPDPDDFVPDRFTTRREKGDSSAYLVSASPEHLGFGLGRHACPGRFFAANELKIVLSHMLMKYDIKLPDNGAVAPSKSGIFLATNPDARICVRRRKEEIVI