ATG10

Ubiquitin-like-conjugating enzyme ATG10

235 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy (By similarity). Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5 (By similarity). ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS) (By similarity). Likely serves as an ATG5-recognition molecule (By similarity). Autophagy is required for proper vegetative growth, asexual/sexual reproduction, and full virulence (PubMed:28894236). Autophagy is particularly involved in the biosynthesis of deoxynivalenol (DON), an important virulence determinant (PubMed:28894236).

Belongs to the ATG10 family.

26.569 kDa

MSIENFPSLNSEEFTEACHHLDRQYCQAPLGSERARWKLRLCNALCTDFSYGGGFTTYVQIRRPLEFDLDHGDLSLDLDGFSFSDEKGPHVSIAEDKDMLDAEEADEAALIRQRARPEIAMVEYEIHLHPTYRVPCLWFTLRNLPADEPAFDVDTVFRRLVPDEYKAGLRTLGNVGGISADHHPITGVPSFFVHPCLLGDAISKFECDRTNYLMIWLGLVGGCVGLWVPKEMAMQ

atg10

Ubiquitin-like-conjugating enzyme ATG10

230 amino acids

E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of atg12 to atg5. atg12 conjugation to atg5 is required for autophagy. Likely serves as an atg5-recognition molecule (By similarity).

Belongs to the ATG10 family.

27.236 kDa

MLTSKDFRDQAINLIKKWNNIIDEIPWQWNQINELNNESKGYFTTKRYHKINNNNNNNNNNNIENKNNNNIENFEEIKETIDDSSTTIIKSNNNNNENNIIIFQFDIIYSKSYQVPVLYLNGFSSFDSSPLSWNEIWNNLPLSNLDKNQQSTIPYITQVEHPILGNPCYQLHPCETDNLMKLILLKEKDYNDNNDKKEYFKDYYLLSWLSIIGPMVNIKIPFDLLKNNNI

ATG10

Ubiquitin-like-conjugating enzyme ATG10

225 amino acids

E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. The ATG12-ATG5 conjugates is required for the formation of autophagic vesicles and for the timely progression of senescence and programmed cell death (PCD). Likely serves as an ATG5-recognition molecule. Confers some resistance to nitrogen and carbon starvation. Is also involved in the formation of anthocyanic vacuolar inclusions (AVI). Promotes an autophagic process that constitutes a pro-survival mechanism by controlling the containment of host tissue-destructive microbial infections during necrotrophic pathogen infection, but negatively controls SA-dependent defenses and basal immunity to bacterial infection during biotrophic infection.

Belongs to the ATG10 family.

25.621 kDa

MDSAREVSDGRLTVEGFSVASRAFADKWKIHNQSFPPWSWVPLINRTLLVSKKEEGYLSLEKIIILSSLEEEIPEDESLNVATDCLEKEETVDHTILVPTMENEAHYYDFHIVYSASYKVPVLYFRGYCSGGEPLALDVIKKDVPSCSVSLLLESKWTFITQEEHPYLNRPWFKLHPCGTEDWIKLLSQSSSSSGCQMPIVLYLVSWFSVVGQVVGLRIPLEMLN

ATG10

Ubiquitin-like-conjugating enzyme ATG10

221 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

25.202 kDa

MIKDGKISNYQFNKHIDEFNELLLRNLRLIPSYSKSGGSDANLDIINNYKKELNSNTKNSKKTYILTRICLSGSYLPNCLLIDFTLSYDDFYMVPVLYFRAFKDNSKSTSGNIDETRVTPIVSTEELVSNYYSVLGLSSDSNLGPTVTLDSHHLITDSSVWFYVHPCETLHRLREFMEADNCLLPCDSEQLQVVKYLSIWYATYSLGGIFPSISLRPTSQP

ATG10

Ubiquitin-like-conjugating enzyme ATG10

220 amino acids

E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3 (By similarity). Plays a role in adenovirus-mediated cell lysis.

Belongs to the ATG10 family.

25.279 kDa

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Atg10

Ubiquitin-like-conjugating enzyme ATG10

215 amino acids

E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3. Plays a role in adenovirus-mediated cell lysis.

Belongs to the ATG10 family.

24.577 kDa

MEDEFFGEKSFQHYCAEFIRHSQQIGDGWEWRTAKECSDGYMCKTQFRIKNEASTPHVGTPASVLTCLPTEENLELPMDDSEVTRPAAVAEVIKHEYHVLYSCSYQVPVLYFRASFLDGRPLALEDIWEGVHECYKPRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTAVLKNSQKINRNVNYITSWLSLVGPVVGLNLPLSYAKATSQSE

ATG10

Ubiquitin-like-conjugating enzyme ATG10

196 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

22.816 kDa

MITYEEYVKQLKELDVYSTVAFKRVVPYVLIQQQQNEDELLLRLRAPSEKLVGEINNGSNKLVIIDLKISYSHVYQEPQLSIQLWETNGRQENQEEEQVDEIYLWYPNNINETLAIPTNLFTIELDTVPRPRVERTTTDNINNSGSKKLMSSSAWYVVHSCDTSEIVGTPIQNYLQRWASVYIASWWGIVRTPNNC

ATG10

Ubiquitin-like-conjugating enzyme ATG10

179 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule.

Belongs to the ATG10 family.

20.626 kDa

MSFKSQLLILAQKLSKGGISCELIEFDECILKLEWHTELLDKNDSLLYEQEEDDILSLMNPMITMHAWIRDSPSFEVPQFFFQPYANGSDPLTKMEQIFELLEGSSQNLAYDALAIGDCPGTVGIAWYIHPCRTRDYFEMLQIDKEDPKYLSLWLLYIHQVLSPLTQPIIKAVDDAEKS

ATG10

Ubiquitin-like-conjugating enzyme ATG10

177 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

20.668 kDa

MITNQQFNDNIEEFISIMLANLKLKGTDFEFSVNNNYVNKWNIDKMYSFVSVSVKQLRIDFTISFDDLYGVPLLNMRLYDNDTFLTSPMAQRTLAVGICRVDLHNHHLLQQPWLQVHPCETLQTIDSHLKNTPTCKYNSVIQYLCCWFGLYGLPSIFPQFSVRPNIYINNVQSCKIK

ATG10

Ubiquitin-like-conjugating enzyme ATG10

170 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

19.657 kDa

MLSAEDFSDQVLRLLPLLRRWRRCEHALWDPRARRLQLSVATARNSARFDVRVDLHPLYAVPQLLLRYWEPDPAVSEYEVWKLHFVDPYQLPLWQPGRFSIALDQVPATSGSAYETWYVVNSCDTDANVGPETDNYMLRWFSLYGQLLDENLGFTLAAALVAPCTDQKKA

ATG10

Ubiquitin-like-conjugating enzyme ATG10

167 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

19.759 kDa

MIPYQEWHSQLQLLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENKLLSHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDTIINLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS

ATG10

Ubiquitin-like-conjugating enzyme ATG10

167 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule.

Belongs to the ATG10 family.

19.76 kDa

MIPYQEWHSQLQSLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENKLLNHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDTIINLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS

ATG10

Ubiquitin-like-conjugating enzyme ATG10

159 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

18.28 kDa

MTLEYEQFVQQLTRLAESRELYKKLPLLRHDLVHSPCCLHLTVPNSTRNTGGHIELLITFSRVYREPLLLIRVWATTALDGIETSQLAHSAETMATLRIPSYLTLGLDTILDAQYPHALQGAWYSVHPCDTRDIVGDDVTVRDTYLDRWVSVFLLWVCR

ATG10

Ubiquitin-like-conjugating enzyme ATG10

155 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

18.203 kDa

MLSLQQYNKQLPEIAKLVSRWDKASRVQLIKEISDHILVVNMRQKQFLTIELQINYDKVYQVPSIRFRLWEHALDDEDVSSSKLLFLSDVELRSIIALNSFSVSLSSDPTTKEVWYHVNNCDTDANVGTEPERYLLRWISLYLQIFDPTLNIMLI

ATG10

Ubiquitin-like-conjugating enzyme ATG10

149 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

17.444 kDa

MKENVFENNVAQLAHYIRHKCTNVRTERTVIFALACRDNIQLEIVVFYHQTYAAPLLTFRIWQLQVSDDIETRRLVFDQTLIDKLVTRNGSLRVDRRVDPAITLVDHPVLGKPFYQLHPCQSAQLLEDVALQGPESLEFWWNFYSSVLI

ATG10

Ubiquitin-like-conjugating enzyme ATG10

147 amino acids

E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy (PubMed:26442587, PubMed:22682742). Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5 (PubMed:22682742). ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS) (By similarity). Likely serves as an ATG5-recognition molecule (By similarity).

Belongs to the ATG10 family.

17.31 kDa

MLTLPEYNEQIPNVRSLLTKWAKVERIQDVQDGLQLDVRLKTDTLLELHIYYDHVYHVPSIKFRLWSLDTEEDISSLRLLTLSDSELRSILNLGTFSVTLSTDMEMKSVYYYINNCDTDANVGSDVEHYLTRWISLYIRIFDLNFVP