Function
Prenyltransferase; part of the gene cluster that mediates the biosynthesis of the aspoquinolone mycotoxins (PubMed:25251934). The first stage is catalyzed by the nonribosomal pepdide synthetase asqK that condenses anthranilic acid and O-methyl-L-tyrosine to produce 4'-methoxycyclopeptin (PubMed:25251934). AsqK is also able to use anthranilic acid and L-phenylalanine as substrates to produce cyclopeptin, but at a tenfold lower rate (PubMed:25251934). 4'-methoxycyclopeptin is then converted to 4'-methoxydehydrocyclopeptin by the ketoglutarate-dependent dioxygenase asqJ through dehydrogenation to form a double bond between C-alpha and C-beta of the O-methyltyrosine side chain (PubMed:25251934). AsqJ also converts its first product 4'-methoxydehydrocyclopeptin to 4'-methoxycyclopenin (PubMed:25251934). AsqJ is a very unique dioxygenase which is capable of catalyzing radical-mediated dehydrogenation and epoxidation reactions sequentially on a 6,7-benzo-diazepinedione substrate in the 4'-methoxyviridicatin biosynthetic pathway (PubMed:25251934). The following conversion of 4'-methoxycyclopenin into 4'-methoxyviridicatin proceeds non-enzymatically (PubMed:25251934). AsqJ is also capable of converting cyclopeptin into dehydrocyclopeptin and cyclopenin in a sequential fashion (PubMed:25251934). Cyclopenin can be converted into viridicatin non-enzymatically (PubMed:25251934). 4'-methoxyviridicatin likely acts as a precursor of quinolone natural products, such as aspoquinolones, peniprequinolones, penigequinolones, and yaequinolones (PubMed:25251934). Further characterization of the remaining genes in the cluster has still to be done to determine the exact identity of quinolone products this cluster is responsible for biosynthesizing (PubMed:25251934).
Sequence
MDRNSFTAYGPATGAITESGEQENDHTKPHTWKTFAKYACFESEAERQWWNDSGALIARFLSLTNGDIDQQYQCLLFVRQVLIPALGPYPPVRRCCINTTEIGMELSLNFQGPGEPVFRVSIDPVSRMTGTPMDPLNINTVNNMITRLASMGIKGFDRTLHHHFTREFCMSEQSMQSYQRDSGEAIAWSQTILAFDFKGGDVVTKQYIWTRHAARASGLHPHSLIRRAISRVENQMHCSAAVELVLEYMETFNADIPVPFFSWDLVDPTQSRFKIYGISWQWSWAKAEEVCTLGGKLNHHDIDLLKKLWHILKLDEFTPTMGFTWNYEIRPGQPKPEVRLYLAICDRSDEEVAQAVVQWFELLGWHERAQSYPETLRYLHKTKSAHTWLSVTVSEKGVYTSLYYHPLGNGSDDFKIRENWF