aroD

3-dehydroquinate dehydratase

301 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

32.856 kDa

MLQYGVLICGVVPVRKPRDIEKALEAPVTCLELRLDYLEADLAEVRPLLEHAVARRVVIFTVRRREEGGQWRGDEEGREALYRKLLELNPHYIDVEAESPIIGEVAKIKGKAQLIASRHDFEKTPPLDVLSQWAKKAAAVGDLVKIVTYAKEPGDGLRVLSLIGAVEKPTVAFAMGPAGAYTRVAAAALGSPIMYVSLGEATAPGQLTADAYYAALLALGITPSGGGLPALREALDWVDGGLMYLLKKRLEVCRDMGRLKKDAGLPIYDDVREAQVLRRAGDFKQIFELVVQMCKAVQLVA

aroD

3-dehydroquinate dehydratase

264 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.996 kDa

MQSSKPIESHGQPIAGGKLPLICVPLVGHTLDEVMAELAIVLPKKPDVLEWRVDFFESIGDVAAVIAAAKAIKSKAGDIPLLFTRRSVMEGGEKIALNEDQVIALYGAVCESKAIDLIDYEMANETANIAQVRAAAKSNDIKLVLSFHNFSSTPGLEALASKFLMADQLGADIAKVAVMPRDPNDVLILLAATQQASQKLRIPLISMSMGPYGSLTRLFGWAFGSALTFAVGARSSAPGQVPIEDLNTVLGILRKAMGDGQTTP

aroD

3-dehydroquinate dehydratase

259 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

28.802 kDa

MNISQKIVSVRGTQIGGEQPCICTPIVGASMEQILSETEEVCRKRPDIIEWRADFFKDIYDPQKVLETALAIRKIAGEIPILFTIRSEKEGGNPVPLTETEKIELFTEVCKSRLVDMIDCELLYEEELASLRQVSKEYGIRMIMSYHNFSSTPPKEELVQKMLQAESYGADIAKVAVMPASPQDLLVLFQATQEARSQLSIPLITMSMGGLGVITRLAGWMFGSAVTFAVGQNSSAPGQIPIEDLKEVLHIVQKHMFHG

aroD

3-dehydroquinate dehydratase

257 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

28.564 kDa

MNISPKAIKVRNIWIGGTEPCICAPVVGEDDRKVLREAEEVCRKQPDLLEWRADFFRAIDDQERVLATANGLRNIAGEIPILFTIRSEREGGQPIPLNEAEVRRLIEAICRSGAIDLVDYELAYGERIADVRRMTEECSVWLVVSRHYFDGTPRKETLLADMRQAERYGADIAKVAVMPKSPEDVLVLLQATEEARRELAIPLITMAMGGLGAITRLAGWLFGSAVTFAVGNQSSAPGQIPIDDVRTVLSILQTYSR

aroD

3-dehydroquinate dehydratase

257 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

28.151 kDa

MAISKGAINVRSIFIGGEEPCICAPVVGVDAEQVLAETRQISAKKPHLIEWRADFFNGIHDDRQVVATAKEIRTIAGDIPILFTVRSEREGGRPIPLTEEEKMRLFETVCQSGAIDLLDYELVHEPYVATVRQLSRQYGVRLILSYHNFDFTPAKEELVAKMRQAGKYGADIAKVAVMPKSLQDVLVLLQATEEARQELPIPLITMSMGGLGAITRLAGGLFGSAVTFAVGQQSSAPGQIPIEEVKDVLSVIMKYSQ

aroD

3-dehydroquinate dehydratase

256 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

28.756 kDa

MTSDALKADPNRLIKIIASLSSTRELLSPEVTKADALEIRLDLITEPIDDALHSLRTSFQGPMVLTVRSSDEGGAYAGGSAGLWKKLEPYIGLVDIIDLEIRFKDHAPQVKEHNKAIIASCHQNRMPDDDEMQALIEELHSFGDIVKIAVQPQTKEDVIRLLKITAACPYPIIMSVTGTVYRYARPLLCLFGSLYTYCYIHSETSPGQYSLREMQLLAHLLSPGFVDPWFEGRPVRSGDASGYYERAEQYRKHLEF

aroD

3-dehydroquinate dehydratase

255 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Belongs to the type-I 3-dehydroquinase family.

28.876 kDa

MKRKVQVKNITIGEGRPKICVPIIGKNKKDIIKEAKELKDACLDIIEWRVDFFENVENIKEVKEVLYELRSYIHDIPLLFTFRSVVEGGEKLISRDYYTTLNKEISNTGLVDLIDVELFMGDEVIDEVVNFAHKKEVKVIISNHDFNKTPKKEEIVSRLCRMQELGADLPKIAVMPQNEKDVLVLLEATNEMFKIYADRPIITMSMSGMGVISRLCGEIFGSALTFGAAKSVSAPGQISFKELNSVLNLLHKSIN

aroD

3-dehydroquinate dehydratase

254 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.279 kDa

MHTSLTVKNTVIGSGRTKIAVPLVARDAADLSSVLSQIKNLPFDIVEFRADFLECAGSIGEVLRHTQAVRDALPDKPLLFTFRRHCEGGSFPCSDDYYFELLDALIESRLPDIIDIELFSGETAVRRAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLKQMEDCGADICKIAVMPQSSEDVLTLLSATLEAKRLVAKPVITMSMGQTGAVSRLAGQVFGSSITFGSGTQNSAPGQIGVSALRAALDCLESGAD

aroD

3-dehydroquinate dehydratase

254 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.279 kDa

MHTSLTVKNTVIGSGRTKIAVPLVARDAADLSSVLSQIKNLPFDIVEFRADFLECAGSIGEVLRHTQAVRDALPDKPLLFTFRRHCEGGSFPCSDDYYFELLDALIESRLPDIIDIELFSGETAVRRAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLKQMEDCGADICKIAVMPQSSEDVLTLLSATLEAKRLVAKPVITMSMGQTGAVSRLAGQVFGSSITFGSGTQNSAPGQIGVSALRAALDCLESGAD

aroD

3-dehydroquinate dehydratase

254 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.157 kDa

MCSCLVVKNTVIGSGRTKIAVPLVARDAAVLSAVLDQIKNLPFDIVEFRADFLECAGSIGEVLRHTQTVRDALPDKPLLFTFRRHGEGGSFPCSDDYYFELLDALIESRLPDIIDIELFSGETAVRCAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLKQMEDCGADICKIAVMPQSAEDVLTLLSATLKAKELAAKPIVTMSMGQTGAVSRLAGQVFGSSITFGSGTQNSAPGQIGVSALRATLDCLENGAD

aroD

3-dehydroquinate dehydratase

254 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.186 kDa

MCSCLVVKNTVIGSGRTKIAVPLVARDAAELSAVLEQIKNMPFDIAEFRADFLECAGSIGEILHHTQTVRDALPDKPLLFTFRRHGEGGSFPCSDDYYFELLDALIESRLPDIIDIELFSGETAVRCAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLKQMEDCGADICKIAVMPQSAEDVLTLLSATLKAKELAAKPIVTMSMGQTGAVSRLAGQVFGSSITFGSGTQNSAPGQIGVSALRATLDCLENGAD

aroD

3-dehydroquinate dehydratase

254 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.238 kDa

MCSCLVVKNTVIGSGRTKIAVPLVARDAAELSAVLEQIKNMPFDIAEFRADFLECAGSIGEILHHTQTVRDALPDKPLLFTFRRHGEGGSFPCSDDYYFKLLDALIESRLPDIIDIELFSGETAVRRAVANAQKNGIAALLCNHEFHRTPPQEEIVCRLKQMEDCGADICKIAVMPQSAEDVLTLLSATLKAKELAAKPIVTMSMGQTGAVSRLAGQVFGSSITFGSGTQNSAPGQIGVSALRATLDCLENGAD

aroD

3-dehydroquinate dehydratase

253 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids (AroAA). Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Belongs to the type-I 3-dehydroquinase family.

28.085 kDa

MKPVIVKNVRIGEGNPKIVVPIVAPTAEDILAEATASQTLDCDLVEWRLDYYENVADFSDVCNLSQQVMERLGQKPLLLTFRTQKEGGEMAFSEENYFALYHELVKKGALDLLDIELFANPLAADTLIHEAKKAGIKIVLCNHDFQKTPSQEEIVARLRQMQMRQADICKIAVMPQDATDVLTLLSATNEMYTHYASVPIVTMSMGQLGMISRVTGQLFGSALTFGSAQQASAPGQLSVQVLRNYLKTFEQNK

aroD

3-dehydroquinate dehydratase

253 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

28.018 kDa

MATVKVRDVVFGAGAPKICVPMVGRTLDQLVNETEVLKVLDFDLAEWRVDFFEHVEDIEEVKSALFEIRARLGEKPLLFTFRSKREGGQREVSDDYYGALNKALAQTGEIDLVDVELFQEQSVVRELVDTAHEHGVKVVMSSHDFARTPVKEEILMRLCRMQELGADLPKIAVMPQNASDVLVLLDATNTMREHFADRPFITMSMSGLGGVTRLAGEVFGSALTFGSAVEASAPGQINAADLRNILNLLHMQT

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.216 kDa

MQPAIKLRNIELGSCRPKLAVPITGTTINDILAATTPILAAQPDVVEWRIDFFKDVTNPEQLKSAGQQLRQALGDIALLTTFRTKGEGGELALSDTEYFKLCETVLDGGFTDALDVERYHDEQAVKQIVAAAHEHQVVVIMSNHDFDKTPAVAEIVKRLTSMVDYGADVAKMAVMPQSVEDVLTLLTATNIARQTLPQPVITMSMGDLGKVSRLAGEVFGSCLSFATVGAASAPGQIALENLRPELEDLKLN

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.501 kDa

MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLKTIDLDVVEWRVDFFEDVKDLVKVKAALDEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.504 kDa

MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.534 kDa

MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVGDEFYFELNETLASTGKIDLVDVELFNEETDVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.601 kDa

MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALDEIRTILPETPILFTFRSAKEGGELAVSDEFYFELNETLARTGKVDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLIRMEALGADLPKIAVMPKSAGDVLTLLDATNTVSEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.476 kDa

MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVFEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.702 kDa

MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLKTIDLDVVEWRVDFYEDVKDLAKVETALDEIRVVLPETPILFTFRSAKEGGELAVSDEFYFELNETLARTGKIDLVDVELFNEEADVLRLIETAHKHDVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSATDVLTLLDATNTVSEKADQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.52 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLTATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.477 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVTDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids (AroAA). Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of a lys-170 at the active site.

Belongs to the type-I 3-dehydroquinase family.

27.467 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.452 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVDSVMAAAKILRKTMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.55 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLTATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.467 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVIAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.353 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTEQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.253 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIQEIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.635 kDa

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLSLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.281 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIALNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Belongs to the type-I 3-dehydroquinase family.

27.649 kDa

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of a lys-170 at the active site.

Belongs to the type-I 3-dehydroquinase family.

27.325 kDa

MKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.429 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKEAVACAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFNADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.46 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVACAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.52 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYRETDFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.546 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYRETDFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRILLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.518 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLVGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.518 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLVGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.566 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLTATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVIAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVIAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.547 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTNDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.49 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLALLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.49 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLALLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVLAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVIAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.574 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADHSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLTATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.467 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.467 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.477 kDa

MKTVTVKDLVIGAGAPKIIVSLMAKDIARVKSEALAYREADFDILEWRVDHFADLSNVESVMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVTDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVIAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.483 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVMAAAKILRETMPEKPLLFTYRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

252 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.449 kDa

MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVESVIAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTGDDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSDVLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVNDLRTVLTILHQA

aroD

3-dehydroquinate dehydratase

251 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.279 kDa

MTNAVTVKNITFQEGETLICVPLIGKTLDEILGNAHGLVDAGADIIEWRVDHFTQVRDMTQVMAALAEIRGALKALPLLFTFRSKKEGGETEISDEAYFALNREAARSGLVDVIDIELFNDEAQIHALVDDAHAAGVKVIMSNHDFHKTPAQEDIIYRLRRMQDLGADLPKIAVMPQSPQDVLTLLAATLTMKEKYATRPLITMSMGKSGGVSRVTGRLFGSAMTFGTVGQASAPGQIAIAKLREVMDILS

aroD

3-dehydroquinate dehydratase

251 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.252 kDa

MTNAVTVKNITFQEGETLICVPLIGKTLDEILGNAHGLVDAGADIIEWRVDHFAQVREMAQVMAALAEIRGALKALPLLFTFRSKKEGGETELSDEAYFALNREAARSGLVDVIDIELFNDEAQIRALVDDAHAAGVKVIMSNHDFHKTPAQEDIIYRLRRMQDLGADLPKIAVMPQSPQDVLTLLAATLTMKEKYATRPLITMSMGKSGGVSRVTGRLFGSAMTFGTVGQASAPGQIAIAKLREVMDILS

aroD

3-dehydroquinate dehydratase

245 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.279 kDa

MTSTQAVSFDTFQLAAATADLSDESAASDYADIVEFRLDLAYADTSLPDPLTAISAYDHSSSLPLIVTNRPEWEGGAYDGETIDRLEMLITAAKHDAVIAVDIELETLKSQHGKKVARDIRNSGAVIIASTHDFTSTPQQSVLHERLHTAAQLGDIGKLAVTAQTHRDALRVLAATEQASQWGDTVATMAMGALGQHTRVVAPLYGSRIGYAPVNPTDATAPGQYDIKTLSEMIDTLTHTKVEDD

aroD

3-dehydroquinate dehydratase

242 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.012 kDa

MTQIGPFDLEKKAAVVAVILEKPLETSKKAAEKGADILEVRLDLLGIRNPESAAKIIREIKSETGLPVLVTNRSVAEGGKWEGKEVDRTELLVALLSLKDGPDAVDIELSASREDRDKVIKAAKAHGKTVIISSHDFSKTPSPQEMTATLAEMFLAEADIAKIAVMPGSMEDVLNLLKVTLEFKNTGKTVCTIAMGKPGKHTRVVAPLYGSVLTYASIESNAVAAPGQLPVDEVKKIMEMLK

aroD

3-dehydroquinate dehydratase

242 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.245 kDa

MIHIGQLDLEKKAAVVAVILEKSLEISRKAAKMGADLLEIRLDLLGIRDLETAAETIRKVKSETGLPVILTNRSITEGGKWEGKEADRIELLTNLISLKDGPDAVDIELSAGREARDQVIKAAKAHGKTVIVSSHDFSRTPAFQEMKTILEEAFLAGADIAKLAVMPQSRRDVLNLLRVALDAREAGNAVCTIAMGRLGKHTRVIAPFYGSVLTYAAVNSEVSAAPGQFQVDEVKKILELLE

aroD

3-dehydroquinate dehydratase

242 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.152 kDa

MTQIGSFDLEKKTAVVAVILEKPLENSKKAAEKGADILEIRLDLLGIRTPERAAEVIREIKAETGIPIIVTSRSGAEGGKWDGKEEDRTGLLINLLSLKDGPDAIDIELSAGMKERNRVIKAAKDRETAVIVSSHDFLKTPPLQNMRTIIEEMFLAGADIAKLAVMPLSVGDTLNLLRVTLDFKDAGKSVCTIAMGSQGKHTRVVAPFYGSVLTYASIESNASAAPGQLPVDEVKKIMEMLK

aroD

3-dehydroquinate dehydratase

241 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.99 kDa

MSKVDVAVTIAPKEEITDQLKKDLIREQKSIDIIELRIDQRESFEIADLERLFKTLKDLQLDVQVLVTYRTSVQGGKGQKNGNTYYEFLQDLIQIQGYDMVDIEWDEAQTEILLQLIVQAQSAGLKVVLSQHDFDKTPNLEVLKFLYFKMNKLGADIVKLAVMPNEKQDVLNLLEALATASESIEAKPVGISMSHLGLISRTAQGVFGGIISYGCLGTPQAPGQIHVGQLKELLNIYEINK

aroD

3-dehydroquinate dehydratase

241 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.366 kDa

MTNVEVAATVAPNQLLDTLTLDNIKEYSNDIDIIELRIDQWEDRHLELLKSNLEQLQELNINANVLVTYRTISQGGKGEMTHEAYMTLLKEIIKNHHCQMIDIEWDSDFDVFAHRDLINLAHRYNKQVVISYHNFQETPDIDILKFTYYKMNQLNPDYVKIAVMPQDKEDVATLLEAVATSADTLDAKVIGISMSKVGLVSRTAQGVFGGTVSYGCLGEPQAPGQIHVKTLKQQLLFYSNH

aroD

3-dehydroquinate dehydratase

240 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.502 kDa

MHLEFTTGQTQTAVSLMPRHLDDCLRELILINQKKDAIDILEWRLDYWQAPAQLLTAAEKIAALDLPLILTVRTTNDGGLASAQDYLTYYAPLIKAHIGQAIDLEWSLAAEQRHQLAELAHQQHYQVLLSHHDTVQTPDNDTLRTQLLAMQADPDADLLKLATTAQSPADTTRLLAATQSFTHQFDKPLTTMAMSEFGVASRIFGGQFGSAISFGYLETPSAPGQLPIEQLKGLLTTNQA

aroD

3-dehydroquinate dehydratase

239 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.894 kDa

MTEVKVAVTIAPEQELSQSTIDDLIQFQDSIDIIELRIDQWTNLNEIAIEKVVEDLQSLKLNKKLLVTYRTSNQGGLGDFGEDDYIQILRKIANCQNIDMLDIEFDQTRSLNILQELIELAHKNQVQVVLSHHNFKETPKLEALKHLFYKMQQLESDYIKVAVMPHGKQDVLNLLNAMSDTADVVSQHVVGIAMSKIGLISRTAQGVFGGSISYGCLDTPKAPGQIHVSTLKKQLSMYE

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.964 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIIKHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.964 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIIKHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.869 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGVPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.869 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGVPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.964 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIIKHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27 kDa

MTHVEVVATIAPQLYIEETLIQKINHRIDAIDVLELRIDQIENVTVNQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.869 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGVPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.869 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGVPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.964 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIIKHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.964 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIIKHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

27.053 kDa

MTHVEVVATITPQLYIEETLIQKINHRIDAIDVLELRIDQFENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVIISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.937 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.869 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFTNDSYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGVPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.937 kDa

MTHVEVVATIAPQLSIEETLIQKINHRIDAIDVLELRIDQIENVTVDQVAEMITKLKVMQDSFKLLVTYRTKLQGGYGQFINDLYLNLISDLANINGIDMIDIEWQADIDIEKHQRIITHLQQYNKEVVISHHNFESTPPLDELQFIFFKMQKFNPEYVKLAVMPHNKNDVLNLLQAMSTFSDTMDCKVVGISMSKLGLISRTAQGVFGGALTYGCIGEPQAPGQIDVTDLKAQVTLY

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.944 kDa

MTHVDIAATIAPEDKLSKTLLKDIKVNEESIDIIELRIDQWPSFNKALLNEVIKQLKIFHLKILVTYRTSVQGGKGAVNEQEYLNILGELIECPQFDMIDIEWSSAVKIEKYTHLVQRAQQKGLEVVLSHHNFQETPALDELKFIYFKMQKLNPEYLKLAVMPKCQEDVLHLLEAMSLTAKHTTCRIVGISMSSLGKVSRIAQGVFGGTLSYGCIEEPQAPGQIHVSKLKSMVSFYED

aroD

3-dehydroquinate dehydratase

238 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.944 kDa

MTHVDIAATIAPEDKLSKTLLKDIKVNEESIDIIELRIDQWPSFNKALLNEVIKQLKIFHLKILVTYRTSVQGGKGAVNEQEYLNILGELIECPQFDMIDIEWSSAVKIEKYTHLVQRAQQKGLEVVLSHHNFQETPALDELKFIYFKMQKLNPEYLKLAVMPKCQEDVLHLLEAMSLTAKHTTCRIVGISMSSLGKVSRIAQGVFGGTLSYGCIEEPQAPGQIHVSKLKSMVSFYED

aroD

3-dehydroquinate dehydratase

235 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.697 kDa

MIFFLLEGEREIITEICGSIIESNEKDIFKTLDKAVDLDVNYIELRLDVIENITSKKATSIIEKIRNVTDIPIILTNRTKYEGGYFPSTEEDRIKILMDNASLVEYTDIELSTNENLRQEVIDNANRTIISYHNFEKTPSSEYLENVVNSALNVGDIAKIAVKPLNIEDTYVLLRLLMEYDDLIGISMDKLGSYTRILGPILGSPVTYTAITDESAPGQFDVKTTRDILKKLKNY

aroD

3-dehydroquinate dehydratase

233 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.711 kDa

MLKIGTFDLEERPAIVAAISNEPLQQCKTAAEHGADILEIRFDLLGITTSKEAANLLRMLKGTTSLPCIATNRLQSQGGNWEGTEENRIALLEDIMHLTDAVDIELETDEQLRDRIVKKAKEESKTTIISSHDFERTPDKETLKSILDHSHDAGADIAKLAVMPENMQDVLNLLEVTLEVDDVCTISMGKLGKHTRIIAPLYGSKLTYASVSDAVAPGQLKVEDLKKAMEMME

aroD

3-dehydroquinate dehydratase

233 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.508 kDa

MLNTPRICVVVIGKTLEEFLSQLEAAQTAVDFVELRIDYLEQINPNWVRIIKNHTHKKAILCCRARADGGKFLGTPEAQQEILQAGNDLGFDYLDIDLPVANKISIHEKKAKIIISYHNFLHTPPITELNFLLENMRLFNPDVFKFATKSEQYEDVKTLFKLLINKKNNENMIVLGMGEQGKIIRLLSPLLGGYLTFSSINGAISAPGQIDFKTMQDFYQRFYKISSPLKGED

aroD

3-dehydroquinate dehydratase

230 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.638 kDa

MPIIKSSRVNIGRFTIGGSIPIVIISIFDHDAKSLTEKFETKKLSDKNLYEIRFDLFDKVNIDEELEIIRALDEMDIDYIFTYRGHDPEKIYETAITKMVPAVDMDLSLLNKVNRRSPDTRIMVSYHTDSSKDMIEKLDEMLKANADIVKVACNYKDEKNFFKDLIEIAQRKEISGKPVLFIPMGKSFLRVISAYYVSDMVYAKYDKETAMGQPDPDYYNKAFSLFNYIG

aroD

3-dehydroquinate dehydratase

229 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.269 kDa

MRRTKIVVPIMLTELTELEKVSVSDYLSADIVEWRADFLSADDIFEMAPKFFEKFKESKILFTLRTVREGGNIQVSEKKYLQILQEILKFEPDYIDVEYFSHGPSFAALKNYREKIVLSYHNFDEVPTDLTSRLIKMHEEGTAFVKVAVMPERECDVLDLLQITRDMTLEYGNHFISMAMGDLGRLSRISGYLTGSCWTFAGLENSSAPGQISLKETVEILDLLENELA

aroD

3-dehydroquinate dehydratase

229 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.864 kDa

MDFESFTLLAATDDLGVEPAARVDADGLELRMDFADEPLAQLDAYDGDLPILVTNRPTWEGGEAADTAGRLDALETALEHDAVTAVDLELAALEGAGDHDAGRVADAARDRGASVVVSTHNFESTPDREAIVSRLERACAHGDVGKMASTAQSPDDVLAMLGATRELTAEGEQVATMCMGAAGRHSRAVAPVYGSRIGYAPVDPADATAPGQYDLATLRTLVGQLQSDA

aroD

3-dehydroquinate dehydratase

229 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.309 kDa

MRRTKIVVPIMLTELTELEKVSVSDYHSADIVEWRADFLSADDIFEMAPKFFEKFKESKILFTLRTVREGGNIQVSEKKYLQILQEILKFDPDYIDVEYFSHGPSFAALKNYREKIVLSYHNFDEVPTDLTSRLIKMHEEGTAFVKVAVMPERECDVLDLLQITRDMTLEYGNHFISMAMGDLGRLSRISGYLTGSCWTFASLENSSAPGQISLKETVEILDLLENELA

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.352 kDa

MPLYSGDKISIGKFVIGNPMPIVVTSVFYEDVSTFVERLQTKVLSDKNLYEIRFDMFTEREISDEEELISAMREMDIDYIFTYRGKDARKYYETAIRKMAPAVDIDMDLIGKLEAKPTVTKVIGSYHTSDSEAMMSALDRMIDSDVDMVKVACSYSEDQEFLGDLKRIIDIRKNRRKPIAYVPMGRTFWRALAGYYVSDIVYAMADRPTAYGQPPADYYYQAFKALFY

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

228 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

26.101 kDa

MRIVAPVMPRHFDEAQAIDISKYEDVNLIEWRADFLPKDEIVAVAPAIFEKFAGKEIIFTLRTVQEGGNITLSSQEYVDIIKEINAIYNPDYIDFEYFTHKSVFQEMLDFPNLILSYHNFEETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATISMGKLGRLSRFAGDVIGSSWTYVSLDHVSGPGQVTLNDMKRIIEVLEMDISN

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.842 kDa

MLLQNIPAIAVVLKDKDVLSIPKEELKGADLIELRVDMFEKTENISDIFETAKRKYNLPLLCTIRLPEEGGKREIKNRVEIYQAVIPFCNFFDIEIFSNEAPFLRQLSIKNNITLIGSYHNFINTPSMEQLEEVFDRGKTMGMDIIKIATMVNEKKDIETLLYFTLRHKLDRIIVLGMGQKGIPSRIINPVFGSMITYASLNEISAPGQIHLKDMVHIFKVMGLRG

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.703 kDa

MKIVAPVMPRNVEEAQSIDVSKYQDVNLIEWRADFLPKEDIVSVAPAIFEKFAGREIIFTLRTSQEGGHITLSDQEYVDLIKEINAIYNPDYIDFEYFSHKAVFHEMLDFPNLVLSYHNFDETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATMSMGKLGRLSRLAGDVVGSSWTFVSLDQASAPGQVSLADMKRILHVLESED

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.731 kDa

MKIVAPVMPRNVEEAQSIDVSKYQDVNLIEWRADFLPKEDIVSVAPAIFEKFAGREIIFTLRTSREGGHITLSDQEYVDLIKEINAIYNPDYIDFEYFSHKAVFHEMLDFPNLVLSYHNFDETPENLMEAFSEMTKLAPRVVKIAVMPQSEQDVLDLMNYTRGFKTLNPEQEFATMSMGKLGRLSRLAGDVVGSSWTFVSLDQASAPGQVSLADMKRILHVLESED

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.048 kDa

MEFQDFLLAASTGDLGAAPAAPEHVDLVEFRMDLAADPLAALDDYDGVLPVLATNRADWEGGAAADGGDRIDALAEAARTDCVAAVDIERSALVDDDTADGAEALAAARSTDTTTVVSAHDFDGTPSLSAMADLLGEACSLGDVGKLAVTPQDRGDALDVIRVTHEYSAAGMTVATMGMGDLGRHTRAVTPLYGSKLGYAPVADGETTAPGQYAPAALQALIADLQ

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.048 kDa

MEFQDFLLAASTGDLGAAPAAPEHVDLVEFRMDLAADPLAALDDYDGVLPVLATNRADWEGGAAADGGDRIDALAEAARTDCVAAVDIERSALVDDDTADGAEALAAARSTDTTTVVSAHDFDGTPSLSAMADLLGEACSLGDVGKLAVTPQDRGDALDVIRVTHEYSAAGMTVATMGMGDLGRHTRAVTPLYGSKLGYAPVADGETTAPGQYAPAALQALIADLQ

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.974 kDa

MRKTKIVVPIMLTELAELEKVSVSDYRTADIVEWRADFLSADEILEMAPKFFEKFKESKILFTLRTVREGGNIQVSEKKYLQILKEILTYNPAYIDVEFFTHGPSFAALKDFRDKMVLSYHNFDEVPSDLTNRLIKMHEEGTAFVKVAVMPERECDVLDLLQITRDMTLEYGDHFISMAMGDLGRLSRISGYLTGSCWTFASLENSSAPGQISLKETEYILDILEK

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.335 kDa

MCLRELDLNGLRIKTPAIVASLGADAERVASRAESEGADIIEVRLDLLADPDVIRDIRSTVSLPLIATNRIASEGGSFRGSEERRISILRDASRFSDIIDIELMAPGRDMLLKNISCPALISYHDFSGVPDNLKSIIEDAMRAGADLVKIAVTPHSMQEALAILRILLDVDCPLCIIGMGAVGRHLRAVAPLYGSLLTYGYVTGPTAPGQMSVRELDTALRCLGAR

aroD

3-dehydroquinate dehydratase

226 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.531 kDa

MHSRKICVSLGQPTMPQALEASLRIFGADVIEVRLDYIDVPEIDPFVESLATDLLFTCRPTWEGGLFAGTEEDRLALLAEAVRAGAAYIDLELRSAEESHQYLRTYLAERETELILSYHDFESTATLAKLTGIIDQMQDAGADIGKLITTANSAADVVRVFQVLEYAAKKGLPLIAFCMGEAGAVSRVASCDLGGYMTYCCADGAEVTAAGQITISEMRGIFARYP

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.598 kDa

MKIVVPVMPRSLEEAQEIDLSKFDSVDIIEWRADALPKDDIINVAPAIFEKFAGHEIIFTLRTTREGGNIVLSDAEYVELIQKINSIYNPDYIDFEYFSHKEVFQEMLEFPNLVLSYHNFQETPENIMEIFSELTALAPRVVKIAVMPKNEQDVLDVMNYTRGFKTINPDQVYATVSMSKIGRISRFAGDVTGSSWTFAYLDSSIAPGQITISEMKRVKALLDAD

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.598 kDa

MKIVVPVMPRSLEEAQEIDLSKFDSVDIIEWRADALPKDDIINVAPAIFEKFAGHEIIFTLRTTREGGNIVLSDAEYVELIQKINSIYNPDYIDFEYFSHKEVFQEMLEFPNLVLSYHNFQETPENIMEIFSELTALAPRVVKIAVMPKNEQDVLDVMNYTRGFKTINPDQVYATVSMSKIGRISRFAGDVTGSSWTFAYLDSSIAPGQITISEMKRVKALLDAD

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.598 kDa

MKIVVPVMPRSLEEAQEIDLSKFDSVDIIEWRADALPKDDIINVAPAIFEKFAGHEIIFTLRTTREGGNIVLSDAEYVELIQKINSIYNPDYIDFEYFSHKEVFQEMLEFPNLVLSYHNFQETPENIMEIFSELTALAPRVVKIAVMPKNEQDVLDVMNYTRGFKTINPDQVYATVSMSKIGRISRFAGDVTGSSWTFAYLDSSIAPGQITISEMKRVKALLDAD

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.73 kDa

MKLVVSVTPRNLEEAQQIDAQRFVDADLIEWRADFLEKEEILKVAPAIFEKFAGRELIFTLRTKDEGGHIQLSDDEYVEMIKKVAQLYQPDYVDFEYFSHKDKIDEMLEFPNLVLSYHNFEETPENMMEILSELTSLTPKAVKVSVMANSGQDVLDLMNYTRGFKTLNPEQEYVTISMGRVGRISRIASDLTGSSWSFASLDEATAPGQISLSSMKKIRDILNEN

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.783 kDa

MKIVVPVMPQNIEEANQLDLTRIDSTDIIEWRADYLVKDDILTVAPAIFEKFSGHEVIFTLRTEKEGGNISLSNEDYLAIIRDIAALYQPDYIDFEYFSYRDVLEEMYDFSNLILSYHNFEETPENLMEVFSELTALAPRVVKIAVMPKNEQDVLDLMNYTRGFKTLNPNQEYVTMSMSKLGRISRLAADLIGSSWTFASLEQESAPGQISLADMRKIKEVLDAN

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.719 kDa

MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQLYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.753 kDa

MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQFYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.719 kDa

MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQLYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA

aroD

3-dehydroquinate dehydratase

225 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.753 kDa

MKLIVSVMPRSLEEAQALDATRYLDADIIEWRADYLPKEAILQVAPAIFEKFAGRELVFTLRTRSEGGEIDLSPEEYIHLIKEVAQFYQPDYIDFEYYSYKDVFEEMLDFPNLVLSYHNFQETPENMMEILSELTILNPKLVKVAVMAHTEQDVLDLMNYTRGFKTLNPEQEYVTISMGKVGKVSRITADVTGSSWSFASLDEVSAPGQISLASMKKIREILDEA

aroD

3-dehydroquinate dehydratase

224 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.198 kDa

MYSQTKIAIPIFQAKKEDVIKVAEDCIEKGADVLEFRIDALDNPNFDDIKEIIEEINFPIIATNRISSEGGSFKGSEEERIDILLKCAPLVDYVDIELQSDDRYIKQIHDTGVTTIVSYHDFHKTPEINEIMYIVEKEQKLGDIAKVAFMPNDLDDTLKILAILSHCENTIAISMSDLGSYTRVMASKFDSPITFAAGRDVTAPGQIDIETMKSLLNMDLNLME

aroD

3-dehydroquinate dehydratase

222 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.366 kDa

MKNPPVCCVITRLPEAESLKKSEGAAFYELRLDLLGESWREAAAMLDKPFMATCRRSAEGGSFSGSEEERIGLLEKAAAAGAFMLDIEYSTPHLGEVLKRLRTQSKCLVSHHNFADTPSAGDLKTLVKDMLNYPADIYKVITTATSINDNIKLLNLIKEIPDKKIVAFAMGNLGILSRILCPLAGSPFTYASLNDSNQSASGQMTLAQMIEIYRSVNYENHT

aroD

3-dehydroquinate dehydratase

222 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.476 kDa

MKIPPICCVITQLPQAETLKKSEGAAFYELRLDLLGENWRETAVLLNKPFMATCRRSAEGGSFKGNEAERINRLEKAASAGAFMLDIEYSTPNLEEVLGRLRPQAKCLLSHHNFTDTPSAAKLKTLLKDMLTHQADIYKVITTATSINDNINLLNLTKEIPDKKIVAFAMGEPGILSRILCPLAGSPFTYASLNDGNKSASGQMTLAQMIEIYRSVNYANHT

aroD

3-dehydroquinate dehydratase

222 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.476 kDa

MKIPPICCVITQLPQAETLKKSEGAAFYELRLDLLGENWRETAVLLNKPFMATCRRSAEGGSFKGNEAERINRLEKAASAGAFMLDIEYSTPNLEEVLGRLRPQAKCLLSHHNFTDTPSAAKLKTLLKDMLTHQADIYKVITTATSINDNINLLNLTKEIPDKKIVAFAMGEPGILSRILCPLAGSPFTYASLNDGNKSASGQMTLAQMIEIYRSVNYANHT

aroD

3-dehydroquinate dehydratase

221 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.967 kDa

MNTKICVPVFEKTAPEVTESAGRAIDAGADILEIRIDGLQNPGEVNIRELIEDIGFPVIATNRSPVEGGHFSGSEDERIKLLMAAAEVADFVDIELSSAREDIERVTGSARRSIVSYHNFRETPSLEALLRIVRMAKEMGDIAKVAVMPENLADTLVVLQLLTFEEDTVAISMGELGKYTRVAAALFGSPITFASMGRGTAPGQMDVDVTRKMIGELMPED

aroD

3-dehydroquinate dehydratase

220 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.045 kDa

MICLPVVEDSVEKAIKTAEKYLEIADIVEFRIDMLKEVSEEDIEKFAKYPCIITVRADWEGGYWKGNNEERLNLIKKAIECNAKFVDIELREEKNKELVKFRDEIGSKTKIIISYHDFEKTPSKEKLVEIVEKALSIGDIAKFATMANSKEDVLNILEVINKYPGKIIGIGMGEKGKLTRILGVYFGSILTFASYKGKSSAPGQVDIDTLKEIWRLMDLK

aroD

3-dehydroquinate dehydratase

220 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

25.651 kDa

MRPLIVASLPIKKIEDLKLIENFLDADLIELRLDYLREREVSLISDYYEFLDKYKKKLIVTLRDKGEGGINQLADELKIKILNELYERQYLYDIEVSFLQKYDIPYDNRIVSVHYFNYLPTLEKIKEIVSKFSEKAFSVKIAVPSLKGYKEVLLPLLEYENVTVIPMSNNSLERIAVGLLGSKLVYSYAIEPLAQGQLYYKKVIQIFNYINDITTSSLVT

aroD

3-dehydroquinate dehydratase

219 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.952 kDa

MDFPPKVVASVTSKDDAKEAIALGADVVEVRVDLVGGDGPGLVESIYYDIGCPIIVTIRPKFEGGEFDGTDAERVQLFKKLTPYADFADFELRAKNLDELLTTITGTDAVPIVSYHDFDRTPSNEEMLSIINRSVEKGAIGKLAVMPKDMTDVLRLLEITLKSKRPVCTISMGSLGQHSRLVAPVYGSLLTYGYVRRPVAPGQIRVDQLLEGLRILGLR

aroD

3-dehydroquinate dehydratase

218 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.567 kDa

MICIPVIDKNINDALKSAEEALKVADIVEFRADLLESVDKQDIEKMAKYPSIITIRADWEGGEYTGDNNKRIELYKTAIENNVKFIDIELKEEKNKELVEFRNKIGSKTKIIVSYHDFEKTPSKQDLMEIVEKELKIGDIAKFATMAQNKNDLLKIFAVISIYEGKIIGIGMGEVGKLTRIIGVELGSILTFASMEGRSSAPGQVDVVKLKKIWELLK

aroD

3-dehydroquinate dehydratase

218 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.717 kDa

MICIPVIDEDMSDAINSAKEALKYGDIVEFRVDLLNNVTFEDITEFSKIPSIITIRAEWEGGAWKKSNEERIELLKHAIKNNAKFVDIELKEEKNLELVKYRNEIRSNTKIIVSYHDFEKTPEIDELIDVVEKELKIGDIAKFATFANSKEDTLKILNLMNKYYGKIIAIGMGESGKLTRILGLDFGSILTFASMEGKASAPGQVDVKKLKEILELIE

aroD

3-dehydroquinate dehydratase

218 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.628 kDa

MICIPVIDENVSDAINSAKEALKYGDIVEFRVDLLNDVTFEDIEKFSKIPSILTIRAEWEGGAWKKSDNERIELLKYAIKNNAKFIDIELKEERNLELVKYRNEIGSKTKIIVSYHDFEKTPEIDELIDVVEKELKIGDIAKFATFAHSKEDTLKILNLMNKYSGKIIAIGMGESGKLTRILGLDFGSILTFASMEGKASAPGQVDVKKLKEILELIE

aroD

3-dehydroquinate dehydratase

218 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.603 kDa

MICIPVIDENVCDAINSAKEALKYGDIVEFRVDLLKDVTFEDIEEFSKVPSIITIRAEWEGGNWKKSDNERIELLKHAIKNNAKFVDIELKEERNLELVKYRNESNSNTKIIISYHDFEKTPEIDELIEVVEKELKIGDIAKFATFAHSKEDTLKILNLMNKYAGKIIAIGMGESGKLTRILGLDFGSILTFASMEGKASAPGQVDVKKLKEILKLIG

aroD

3-dehydroquinate dehydratase

218 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.532 kDa

MICIPVIDKDVSDAINSAKEALKYGDIVEFRIDLLNDVNFKDIEEFSKIPSIITIRAEWEGGAWRKSNEERIELLKNAIKNNAKFIDIELKEEKNLELVKYRNEIGSTTKIIVSYHDFEKTPEIDELIDVVEKELKIGDIAKFATFAHSKEDTLKILNLMNRYSGKIIAIGMGESGKLTRILGLDFGSILTFASMGGKASAPGQVDVKKLKEILKLIN

aroD

3-dehydroquinate dehydratase

218 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.583 kDa

MICIPIIDNTVEKALISAKEALKYGDIVEFRLDLLDNLTKFDIEKFAKIPSIITIRANWEGGAWKESNNKRIEFLKHAIKHGAKFIDVELKEEKNLELVTYRNEIGSKTKIIVSYHDFEKTPEINELIDVVEKELKIGDIAKFATFSNSKKDVLKILEVMNKYPGDIIAIGMGESGKLTRILGLRFGSILTFASMKGKSSAPGQIDVTKLKEILNLIE

aroD

3-dehydroquinate dehydratase

217 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.817 kDa

MKIAIPITDENFDEVLLKARNADILEFRVDSFTNKDISFVSGLLKKAKENGFETILTIRSEKEGGAYVENRVEMFEKLMPLSDYTDIELSSTDIIAYISRLSKEYNKKLIVSYHNFEMTPANFVIKETIREALRYGDIPKIALKANSYEDVARLMCSAIDIKTPKILISMGEFGKISRIAGFIFGSFISYAYLEKPNAPGQLSLEEMLKLKEMFYLR

aroD

3-dehydroquinate dehydratase

217 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.83 kDa

MPKLAGVIIAKTIEEAVKKIKLHEADLYELRVDYLESMENIELLLPHSNKLIVTVRKVEEGGAKRIEEQERLKLFEKFAKIKPAYFDVELYSNIVEDVINLSSKIGSKVILSYHNFSKTPSYQTLQSILDSMIELEPDIIKIVTYARDFRDNIEVIKLYENSENLIAFCMGEKGKISRIFSALYSPFTYVSIDNSVAPGQFTVGEMRKILELLGETK

aroD

3-dehydroquinate dehydratase

215 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.919 kDa

MIIATLTGRTIEDMVELAIEAVEQGADALEVRLDYLENLDMSTALRAVRECTRYERVVATLRREEEGGLYKGDEDRRLEILERVSSEADYVDLELDVAEEEIISPSCETIVSYHNFENTPPKEELIGIRDRCAELGDVAKVVTMARGHEDALRILEVVRTAEAPTIGFAMGEEAKYTRVVSVLIGGFATYAAVRKKAAPGQLTVEETRKLLELLG

aroD

3-dehydroquinate dehydratase

215 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.146 kDa

MIVGVVLAKNAQKAVEKIKSGEADLYEVRLDHFSSFDGLEELEPFAPNLIFTFRSYEEGGRREASDEERLRVYKRVLELYPAYVDVGLNSGIAERVVKEAREKRVGVVLSYHNFEETPDFWELLGVVKAMEALEPDVMKIVTMARSLGDNLRIARLYEGRENVVAFCMGSLGRLSRLISALLAPFTYASLDEEAAPGQLTVEELRRAIEVVGDGR

aroD

3-dehydroquinate dehydratase

215 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.593 kDa

MYAVASIPFTDLGQVKKLIIKSAAAGADFVELRLDYWTRKETPPFLEMIELARNYGLDVIVTVRDPEEGGVWSPPWRGEAYEMASEAGAVCDVEVKKFKELPCDRAILSVHYFRKPPREGEVRKLSQRALEAGAWAFKVATVVTDFPSYFLLFSESVHPRTAFMPMGEGTEALRLASALLGSFLNYGSVGEATAPGQVSVRQLTKALSALGGRGD

aroD

3-dehydroquinate dehydratase

215 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.51 kDa

MIATVILADSIKEAIEKIKSSSSDLYELRADSLKDYSKLELLEPYSEKLVVTIRSKDEGGFKELSDEKRLELYSKFLEIKPRYVDVEFRSKIKDEVMEIAKRVGSRVILSYHNFRETPPFGVLYNLLEDMESEGADIVKIVTHASSPKDNIRIIRLYEFADNLIAFCMGSKGKISRIFSSMYSPITYVALDKKAAPGQLTLEELRVILKILGEGR

aroD

3-dehydroquinate dehydratase

213 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.132 kDa

MIAGVVVARNAREAVAKIREGNADLYEVRLDRFESFELAPLKPFADRLIITIRRAEEGGFRRIPEEERLELYRRAMTLKPRYVDVEARSEIAGEVMREARKRRVGVILSHHDFEGTPPFETLMEILQGMASMAPDVVKIVPTANSHLDNVRVLRLYEHAENLVAFCMGPLGRISRLFSALLAPFTYASLEKAVAPGQMSVEELRQLLVMLDGR

aroD

3-dehydroquinate dehydratase

213 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

24.014 kDa

MIAGVVTARNPGEALEKIKTSKFNLYEVRLDSFESFEGLEVLGEYSKKLIFTPRRREEGGIRPLDDGTRLSLYRRVMELKPAYVDVEFASDIAQEVMELAKEKGVGVILSYHDFNGTPDFGKLLTLLEDMEELEPEIIKIVTTANSPLDNLRVLRLYEHAENLIAFCMGPLGRISRVFSAQLAPFTYAPLEGEVAPGQLRAEELDRLRVMLFG

aroD

3-dehydroquinate dehydratase

209 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

22.841 kDa

MQIVASLTDPSQAATAQSQGADLLELRFDLMEGDPVDIARRCRAISKLPLIATFRSALEGGRYFGSPEEWAKKIAPVLPLVDYVDIEQQFARKSGLVREAGKAIIASHHTAEMLPLHVLFVLEQELRAYGDIPKIIVTPHNEDELIDLIAFTRAAKKPVCTGVMGSAFRYARAILPLFGSELAYCHAGVPAAEGQYSVAEFVALMKMLS

aroD

3-dehydroquinate dehydratase

209 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.679 kDa

MKIVVSVENAAAINEVAEYNPTFIEIRLDRMEGDLQDQVRAIREKTDIPLIATLRSRDEGGRFVGDADLWARIVGPIARYVDIVDVEARYRDHAPFIKSQGVQILASLHTNEMPTVPELGRIDEMLRSYGDIPKIVVRPKTREDLFELVLFTHQAQKPICTSIMGAEFRYARAILPLFGSEFTFSHAGAPTAEGQYHIREMRQLADLLK

aroD

3-dehydroquinate dehydratase

204 amino acids

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate.

Belongs to the type-I 3-dehydroquinase family.

23.53 kDa

MNRPLIVASLPVTSPGDISRVKDIDADLVELRLDYSREFPRPQDLLPYRDRILVTLRDREEGGQGNFTDNFKETFLNELMKLGILYDVEASFLSRRRVQFREKVVSAHYFHRLPSREEVDCLFSTYREAFTVKIAVSNLPGYREILSYISTKPGSTFMPMSPDPLERLAISLLGSRLLYTYVDSPTATGQLHYLEAKRILNCLF