AROC

Chorismate synthase

536 amino acids

Belongs to the chorismate synthase family.

58.144 kDa

MSSYGAALRIHTFGESHGSAVGCIIDGLPPRLPLSVEDVQPQLNRRRPGQGPLSTQRREKDRVNILSGVEDGYTLGTPLAMLVWNEDRRPQEYHALATVPRPGHGDFTYHAKYHIHAKSGGGRSSARETLARVAAGAVVEKWLGMHYGTSFTAWVCQVGDVSVPRSLRRKWERQPPTRQDVDRLGVVRVSPDGTTFLDANNRLYDERGEELVEEEDKARRRLLFGVDNPTPGETVIETRCPCPSTAVRMAVKINQTRSLGDSIGGCISGAIVRPPLGLGEPCFDKVEAELAKAMMSLPATKGFEIGQGFASVTLRGSEHNDRFIPFERASCSFSESAASTIKHERDGCSAATLSRERASDGRTTSRHEEEVERGRERIQRDTLHVTGVDQQNGNSEDSVRYTSKSEASITRLSGNAASGGAPVCRIPLGEGVRIRCGSNNAGGTLAGITSGENIFFRVAFKPVSSIGLEQETADFAGEMNQLAVKGRHDPCVLPRAPPLVESMAALVIGDLCLRQRAREGPHPLLVLPQHSGCPSC

aroC

Chorismate synthase

422 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

44.977 kDa

MLFMLRWTTAGESHGQALISMIENLPAGLSVSREDVSYQLARRRLGYGRGARMKFEADEVTFVGGVRHGKTLGSPVAVMIGNTEWPKWTTIMSADPIDESDPEVAKEMASGRGAKLTRPRPGHADFSGMVKYDHDEARPILERSSARETAARVAAGTFARALLREVLGVEVLSHVISIGRSEPYEGPSPEFSDLEGIDASPVRAFDSAVEESMIDEIKAAKKSGDTLGGIVEVVVKGLPIGLGSHVSGDERLDAQLAAALMGIQAIKGVEIGDGFEEARRRGSEAHDEMEAAANGGVHRLSNRAGGLEGGMTNGEELRVRAAMKPISTVPRALKTVDMATGEAATGIHQRSDVCAVPAAGVVAETMVALVLARAVLKKFGGDSVEETKRNVQSYLEYVDTRLDWSAEANDVADGEVADGEIR

aroC

Chorismate synthase

416 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.501 kDa

MLRWLTAGESHGEALVGIVEGVPAGVELTTGMVQDALARRRLGYGRGARMKFEQDRVRILGGVRHGLTQGGPVAIEIANTEWPKWQDVMSSDPVDPQVLEGRARNAPLTRPRPGHADLTGMQKYGFDEARPVLERASARETATRVALGVVASQILAALGVRLVSHTTAVAEVAVPEGAPLPGPQDVPALDADPLRCFDAETSAAMVAAVDAAHKAGETLGGVVEVLAEGMPPGLGSYVHWDRRLDSRLAGALMGIQAIKGVEVGDGFRTAQRPGSLAHDETLRADGSVHRVSNRAGGIEGGMSTGDLLRVRAAMKPIATVPRSLHTVDVATGEPARAHHQRSDVCAVPAAGVVAEAMVALVLAEAALEKFGGDSVAELVRNRDSYLAGIPESLRTSPELADPAALAALDEVRGDLS

aroC

Chorismate synthase

415 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

45.029 kDa

MNGNEFGRLFRLTTFGESHGDAMGCTVSGVPAGVELSEEAIQEDLDRRKPGQSMITTSRGEPDKVSIKSGLQDGYTTGTPIGMVIQNKDARSGKYEPFITAPRPSHGDYTYSAKFGTRNWGGGGRSSARETVNWVAAGGVAKQVLAQSDYDVQIKAHVCQIGDVVADDVTWEEMLEHSEDNEVRCGDPDAAEEMRDLADEYQKEGDSIGGAIYFECRGVPRGLGAPRFDSIPARLGQAMYSIPAVTDFELGIGRDARTATGTDYTEDWEFGESEATASENASGDEPRARGDPKPVGNDHGGIQGGITTGDPIYGEVTWHAPVSFPKTQETVDWETGERKEITVTGRHDPVLPPRAVPVVEAMLYCTVLDFMLLGGRINPDRLDDRPGEYDTDYHPSSPRNDPEDADTHATTVDED

aroC

Chorismate synthase

412 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.956 kDa

MLRWITAGESHGRALVAVLEGMVAGVELTSEDIGRQLARRRLGYGRGARMAFEADQVTMLGGVRHGLTLGGPVAIEVGNTEWPKWETVMSPDPVDPAELQNIARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAVGTLAKAFLKQALGVDVISHVISIGDSDPYEGPVPDAADLAAIDASPVRAFDAQAESSMISEIEAAKKDGDTLGGVVEVVVAGLPVGLGSFISGQDRLDSQLAAAIMGIQAIKGVEIGDGFTTARRRGSAAHDEIYPGPDGILRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMSTGDEAVAIHQRSDVCAVPAAGVVAEAMVALVVARAALEKFGGDSLSETKTNVAAYLDAVAQREPRQESSDEQPARRAANTAG

aroC

Chorismate synthase

411 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.827 kDa

MVRWLTAGESHGPALTGIVEGLPAGIPVTTQDVQDALARRRLGYGRGARMKFEQDAVTILGGVRHGRTLGSPVAIQVGNTEWPKWEKVMAADPVPAEELDGLARNAALTRPRPGHADLTGMQKYGFDEARPLLERASARETAARVALGTVARAFLGELGVRIVSHTVAFGEAALPESHPFPVPEDEARLDADPVRCLDPQTSAAMVAEVDDAHRAGETLGGVVEVLVYSVPIGLGSHVHWDRRLDARLAGALMGIQAIKGVQVGDGFATAARRGSAAHDGIARGADGRPRRTSDRAGGIEAGMSTGGLLRVSAAMKPIATVPRALPTVDVATGVETTAHHQRSDVAAVPAAGIVAEAMVALVLADAMLEKFGGDSVAETRRNLEAFRAAVPALPEPGADVVEDGPMGDPLP

aroC

Chorismate synthase

410 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.733 kDa

MLGMLRWTTAGESHGQALIATVEHMPAGVPVTKDEVSYQLARRRLGYGRGARMKFEQDALTFLTGIRHGLTLGSPISIMIGNTEWDKWTTIMSSDALDMEDPDNVAAMSSGRGAKLTRPRPGHADYAGMLKYGFDDARNVLERSSARETAARVAAATVARSFLRETLGVEVLSHVISIGASEPYTGAEPTFADIQAIDDSPVRAFGKDAEESMIAEIEAAKKAGDTLGGIVEVIVEGLPIGLGSHISGEDRLDAQIAAALMGIQAIKGVEIGDGFEEARRRGSEAHDEVFLDDNGVYRNTNRAGGLEGGMTNGETLRVRAGMKPISTVPRALKTIDMENGKAATGIHQRSDVCAVPAAGVVAEAMVTLVLARAVLQKFGGDSLSETKSNIDTYLKNIEERMKFEGLEDGA

aroC

Chorismate synthase

407 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.473 kDa

MLRWITAGESHGRALVAVVEGMVAGVEVTSTAIADQLARRRLGYGRGARMAFERDGVTVLSGVRHGVTLGGPIAIEIDNTEWPKWESVMAADPVDAAELEDSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTIARQFLRQALGVEVLSHVISIGASARYDGPPPGSEDLTVIDASLVRAFDEQVEKSMIAEIEAAKKDGDTLGGVVEAVVLGLPVGLGSFTSGDDRLDSQLAAAVMGIQAIKGVEIGDGFATARRRGSCAHDEMYSGPGGVVRLTNRSGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGEEAIAIHQRSDVCAVPAAGVVVETMVALVLARAALRKFGGDSLGETRRNLAAYQRAVADREAPVAQYCGESGIGG

aroC

Chorismate synthase

407 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.473 kDa

MLRWITAGESHGRALVAVVEGMVAGVEVTSTAIADQLARRRLGYGRGARMAFERDGVTVLSGVRHGVTLGGPIAIEIDNTEWPKWESVMAADPVDAAELEDSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTIARQFLRQALGVEVLSHVISIGASARYDGPPPGSEDLTVIDASLVRAFDEQVEKSMIAEIEAAKKDGDTLGGVVEAVVLGLPVGLGSFTSGDDRLDSQLAAAVMGIQAIKGVEIGDGFATARRRGSCAHDEMYSGPGGVVRLTNRSGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGEEAIAIHQRSDVCAVPAAGVVVETMVALVLARAALRKFGGDSLGETRRNLAAYQRAVADREAPVAQYCGESGIGG

aroC

Chorismate synthase

407 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.546 kDa

MLRWITAGESHGRALVALVDGMVAGVEVTSTEIADQLARRRLGYGRGARMAFERDAVTVLSGLRHGSTLGGPIAIEIGNTEWPKWEAVMAADPLDPAAAAELENSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVVSIGASAPYDGPPPQPEDLPAIDASPVRAFDGQAEKSMIAEIEAAKKDGDTLGGVVEVVALGLPVGLGSFTSGENRLDSQLAAAVMGIQAIKGVEIGDGFETARRRGSRAHDEMYPGTDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPKALATVDLATGDEAVAIHQRSDVCAVPAAAVVVETMVALVLARVTLEKFGGDSLAETRRNIEAYQRSVADREAPAARARAIRG

aroC

Chorismate synthase

407 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.562 kDa

MLRWITAGESHGRALVALVDGMVAGVEVTSTEIADQLARRRLGYGRGARMAFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWEAVMAADPLDPAAAAELENSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVVSIGASAPYDGPPPQPEDLLAIDASPVRAFDGQAEKSMIAEIEAAKKDGDTLGGVVEVVALGLPVGLGSFTSGENRLDSQLAAAVMGIQAIKGVEIGDGFETARRRGSRAHDEMYPGTDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPKALATVDLATGDEAVAIHQRSDVCAVPAAAVVVETMVALVLARVTLEKFGGDSLAETRRNIEAYQRSVADREAPAARARAIRG

aroC

Chorismate synthase

407 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.498 kDa

MLGMLRWTTAGESHGQALVATVEHMPAGVPVTKDEVTYQLARRRLGYGRGARMKFEQDKLTFLTGIRHGLTLGSPISIVIGNSEWPKWTTIMSSDALDMEDPENVAAMSSGRGAKLTRPRPGHADFAGMLKYGFDDARNVLERSSARETAARVAAATVARSFLRETLGVEVLSHVVSIGRSEPYEGPTPTFADITAIDESPVRSFGKEAEASMITEIEAAKKSGDTLGGIVEVIVEGLPIGLGSHISGEDRLDAQLAAALMGIQAIKGVEIGDGFEEARRRGSEAHDEMVRDEDGVYRTTNRAGGLEGGMTNGETLRVRAAMKPISTVPRALKTVDMATGDAATGIHQRSDVCAVPAAGVVAEAMVALVLARAVLNKFGGDSLEETTCNIRCYLERIGKRLEFNDGE

aroC

Chorismate synthase

407 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.429 kDa

MLRWTTAGESHGQALIATVEHMPAGVPVTKDEVSYQLARRRLGYGRGARMKFEQDALTFLTGIRHGLTLGSPISIMIGNTEWDKWTTIMSSDALDMEDPDNVAAMSSGRGAKLTRPRPGHADYAGMLKYGFDDARNVLERSSARETAARVAAATVARSFLRETLGVEVLSHVISIGASEPYVGAEPTFADIQAIDDSPVRAFGKDAEKSMIAEIEAAKKAGDTLGGIVEVIVEGLPIGLGSHISGEDRLDAQIAAALMGIQAIKGVEIGDGFEEARRRGSEAHDEVFLDDNGVYRNTNRAGGLEGGMTNGETLRVRAGMKPISTVPRALKTIDMENGKAATGIHQRSDVCAVPAAGVVAEAMVTLVLARAVLQKFGGDSLSETKSNIDTYLKNIEERMKFEGLEDGA

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.014 kDa

MGPVLRWITAGESHGRALVAVLEGMVAGVEITSTDISEQLARRRLGYGRGARMSFERDAVSVLSGVRHGLTLGGPIAVEIGNTEWPKWETVMATDPVDPAQLADSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTIARSFLRQALGVEVLSHVIAIGPSAPYEGPPPGPGDLPAIDASPVRAYDEAAEQAMIAEIEAAKKDGDTLGGVVEVVALGLPVGLGSFTSGDNRLDGQLAAAVMGIQAIKGVEIGDGFATARRRGSQAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMATGDEAVAIHQRSDVCAVPAAGVVVEAMVALVLARATLQKFGGDSLAETRRNIDAYRRAVAEREAPAARGTA

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.286 kDa

MLRWTTAGESHGRALVAVLEGMVAGVSLTTEDIGAQLRRRRLGYGRGARMKFEQDEITMLGGVRHGVTLGGPIAIQIGNTEWPKWETVMAADPVDPAELAEIARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVVSHVISIGASTPYDGPPPQPADLTAIDDSPVRAFDEAAEKSMIAEIEAAKRDGDTLGGVVEVVVSGLPVGLGSFTSGDNRLDSQLAAAVMGIQAIKGVEIGDGFETARRRGSVAHDEIYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMTTGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALQKFGGDSLTETRTNVESYLRAVAAREPATAQRAQASG

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.286 kDa

MLRWTTAGESHGRALVAVLEGMVAGVSLTTEDIGAQLRRRRLGYGRGARMKFEQDEITMLGGVRHGVTLGGPIAIQIGNTEWPKWETVMAADPVDPAELAEIARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVVSHVISIGASTPYDGPPPQPADLTAIDDSPVRAFDEAAEKSMIAEIEAAKRDGDTLGGVVEVVVSGLPVGLGSFTSGDNRLDSQLAAAVMGIQAIKGVEIGDGFETARRRGSVAHDEIYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMTTGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALQKFGGDSLTETRTNVESYLRAVAAREPATAQRAQASG

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.286 kDa

MLRWTTAGESHGRALVAVLEGMVAGVSLTTEDIGAQLRRRRLGYGRGARMKFEQDEITMLGGVRHGVTLGGPIAIQIGNTEWPKWETVMAADPVDPAELAEIARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVVSHVISIGASTPYDGPPPQPADLTAIDDSPVRAFDEAAEKSMIAEIEAAKRDGDTLGGVVEVVVSGLPVGLGSFTSGDNRLDSQLAAAVMGIQAIKGVEIGDGFETARRRGSVAHDEIYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMTTGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALQKFGGDSLTETRTNVESYLRAVAAREPATAQRAQASG

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.112 kDa

MLRWTTAGESHGRALVAMVEGMVAGVHVTTQDISAQLARRRLGYGRGARMKFEQDQVTMLTGLRHGVTLGGPIAIEIGNTEWPKWETVMAPDPVDPAVLADSAARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLQQALGVEIVSHVISIGASKPYDGPPPQAADLTAIDASPVRAFDAASEALMIDEIEAAKRDGDTLGGVVEVVAHGLPVGLGSFTSGDNRLDSQLAGAVMGIQAIKGVEIGDGFETARRRGSVAHDEIYPGADGVMRSTNRAGGLEGGMTNGLPVRVRAAMKPISTVPRALATVDMATGEEAVAIHQRSDVCAVPAAAVVVETMVALVLARAVLEKFGGDSLAETRANIDSYLRAVATREPSTDGARASG

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.986 kDa

MLRYLTAGESHGEAIIGVLEGAPAQLPLTPDDINEHLARRWLGYGRGGRSKIENDTVHIYSGVRFGKTLGSPISFRIDNGAYEKDKAGWPEKMAIEGEPPEDMEKVTMPRPGHADLAGKQKYEHDDMRPVIDRSSARETAMRVACCSVARRLLNEFGIEVGSHVVRIGDVGFDEPEEWADRRNALIEEGGGASALYETADESATRMIDDGMTERCVEHIDQTKKDRDSLGGVYEVVVTGVPPGLGSYVHWDRRLDGQLVQAICSIQAQKAAEVGDGFFNAHRPGSQVHDPIEPREDGAQAYPRRTNHAGGTEGGTTTGMPLVVRGYMKPIPTLIKPLDSVDTATGEPEPTRYERSDITSVPAASTVAEATVAYTVANAFLRKYGGDSVPAIRRHVEADRAAPNE

aroC

Chorismate synthase

404 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.918 kDa

MEILGGPHFAVAGAGESHGPAVTTIIHGSPPGFRIRRCDVQPFLDRRRPGGNKHGTPRNEKDKVVFLAGLYRDDTDALLTGSKLTVDVDDQSFETEGYEDGFTTGEPIAAIVLSTSKKSGDYTQFSGPTGEVRPGHTDLVKFHQSKGFVDVRGGGRSSYRSTITDVIGGSVARIILRECFGTRFVSSICQVGSLKSKQSLADTLTIDNIDEIETSLGEAEIASIDHEFANEAGELIKETRKRGNSLGAAVEVVAVGVPPLLGQPLYQSLKVRLMGALGGLNAVQSCEIGSGVDVIPRTGSENNDPIRSSGYQSNTHGGLLGGITTGSPLVARVGFKPTSTINLPQDSVNKRLDEIEFELAKGRHDPCVGVRAGVTLESRMAIELLNSVLAYQATAHCGDSIKLF

aroC

Chorismate synthase

403 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.653 kDa

MLRWTTAGESHGQALVALIEHMPAGVPISQDDIALQLSRRRLGYGRGARMKFEADDLTLLSGIRHGLTLGSPIAIMIGNTEWPKWTTIMSPEALDLEDPEVAKAMASGRGAPLTRPRPGHADFAGMVKFDHSEARPILERSSARETAARVAAATVARNFLRETLGVEVLSHVISIGASAPYKGPHPSFADIEAIDASPVRACDKTAEESMISEIETAKKQGDTLGGIVEVIVEGLPIGLGSHTSGEDRLDAQLAAALMGIQAIKGVEVGDGFAEARRRGSEAHDEMVRTDEGVDRETNRAGGLEGGMTNGQTLRLRAAMKPISTVPRALKTVDMSTGGSATAIHQRSDVCAVPAAGVVAEAMVALVLARAVLEKFGGDSLAETKRNIAAYQEYVAGRLEWGEA

aroC

Chorismate synthase

403 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.892 kDa

MLRWTTAGESHGQALIAMLEHMPAGVPISREEISFQLGRRRLGFGRGARMKFEADEVSILGGVRHGYTIGSPIAIMVGNTEWPKWTTIMSADAIDESDPDVAAAMSSGRGARLTRPRPGHADFAGMVKYNHDEARPILERSSARETAARVAAATVARSFLRETLGVEVFSHVISIGRSEIDQTVCPTFEDLGRIDDSPVRSASAQAEASMIDQINAAKKQGDTLGGIVEVIVNGLPIGLGSHISGEDRLDAQLAAALMGIQAIKGVEIGDGFEEARRLGSEAHDEIVLRDGVVARQSNRAGGIEGGMTNGESLRVRAAMKPISTVPRALQSIDMDSGKRATGIHQRSDVCAVPAAGVVAEAMVALVLARAVLEKFGGDSLAETKRNIAAYNEYVKTRIAFDGE

aroC

Chorismate synthase

402 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.943 kDa

MLRWLTAGESHGPELIAVLEGLPAGVPVSPDAIRADLARRKLGYGRGSRMKFEQDALEVSGGVRHGLSLGSPVALRIGNSEWPKWVDLMSPEPIAAEKLAGARGAPLTRPRPGHADLAGMQKYGFDEARPVLERASARETAARVALGAVARSFLGELGITLVSHTLSIGPVRVPEDAVWPTPADVAALDADPLRCFDRATSARMVAEVDAAHKDGDTLGGVIEVLAYGLPPGLGSYVHWDRRLDAQLAAALMGIQAIKGVEVGDGFLTATRRGSEAHDELVAEDGAIVRQSGRAGGTEGGMSTGGVLRVRAGMKPIATVPRALRTIDVATSEAAPAHHQRSDVCAVPAAGVVAEAMVALVLANAVLEKFGGDSIGETARNLRGYLDAISQNLATERVSAPYA

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.792 kDa

MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.792 kDa

MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.792 kDa

MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.792 kDa

MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.792 kDa

MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.792 kDa

MLRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETVMAADPVDPAELADVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLRQALGVEVLSHVISIGASAPYEGPPPRAEDLPAIDASPVRAYDKAAEADMIAQIEAAKKDGDTLGGVVEAVALGLPVGLGSFTSGDHRLDSQLAAAVMGIQAIKGVEIGDGFQTARRRGSRAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDLATGDEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETQRNIAAYQRSVADREAPAARVSG

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.73 kDa

MLRWITAGESHGRALVAVLEGMVAGVEITSTDISEQLARRRLGYGRGARMSFERDAVSVLSGVRHGLTLGGPIAVEIGNTEWPKWETVMATDPVDPAQLADSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTIARSFLRQALGVEVLSHVIAIGPSAPYEGPPPGPGDLPAIDASPVRAYDEAAEQAMIAEIEAAKKDGDTLGGVVEVVALGLPVGLGSFTSGDNRLDGQLAAAVMGIQAIKGVEIGDGFATARRRGSQAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMATGDEAVAIHQRSDVCAVPAAGVVVEAMVALVLARAALQKFGGDSLAETRRNIDAYRRAVAEREAPAARGTA

aroC

Chorismate synthase

401 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.84 kDa

MLRWMTAGESHGPALVAVLEGMVAGVEVTTADIAAELERRKLGFGRSPRMNFEADELEIIGGVRHGRTQGGPVAVRIANTEWPKWEQVMAADPVDPDVLASLARNEPLTRPRPGHADLAGMQKYGFEESRPVLERASARETAARVAVGTVARHFLRQLLGVEILSHVVSLGGVSAESDHLPGPDDLKAIDDNPVRAFGDAATERMMAEVDAAKKDGDTLGGVVEVIAYGLPPGIGSHVHWDRKLDARLAGALMSIQAIKGVEIGEGFANAHRRGSAAHDEIYPAEGERWVRRGSNRAGGLEGGITNGEPLVVRAAKKPISSLPRALATVDVVTGEPAQAMHQRSDITAVPRAAVVAETMVALVLAEAVLEKFGGDSLPETRRNVEGYLAGLRERAEKRQVR

aroC

Chorismate synthase

400 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.174 kDa

MLRWFTAGESHGMELVAILEGLPAGIPVSLEHIGNELSRRRLGFGRSARQKFEKDLVTLSAGVLHGSTLGSPVAIRITNSEWGKWEKIMTPEVPCKSDMSDAKRAQGLYKPRPGHADLVGMQKYGFQNSRLVLERASARETAARVACGAVAKAFLQQLDIFILSHVKQIGSIKIDYEQGAYPRFCDLEAIDSSPVRCFDKNTSEKMKDELHRIKRCGDTLGGVFEVLAYGLPPGLGSYVHWDRRLDAMLSAAIMSIQAVKAVEIGDGLAISALPGSEAHDQIVLESGLLTRMSNHSGGVEGGVTTGSALRISGSMKPISTVPRALKTVDISTRQPANADHQRSDICAVPAAAVVGESMVALTISCAILDKFGGDSLCEIKRNFSGYLNSIPKNLMSVIER

aroC

Chorismate synthase

400 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.174 kDa

MLRWFTAGESHGMELVAILEGLPAGIPVSLEHIGNELSRRRLGFGRSARQKFEKDLVTLSAGVLHGSTLGSPVAIRITNSEWGKWEKIMTPEVPCKSDMSDAKRAQGLYKPRPGHADLVGMQKYGFQNSRLVLERASARETAARVACGAVAKAFLQQLDIFILSHVKQIGSIKIDYEQGAYPRFCDLEAIDSSPVRCFDKNTSEKMKDELHRIKRCGDTLGGVFEVLAYGLPPGLGSYVHWDRRLDAMLSAAIMSIQAVKAVEIGDGLAISALPGSEAHDQIVLESGLLTRMSNHSGGVEGGVTTGSALRISGSMKPISTVPRALKTVDISTRQPANADHQRSDICAVPAAAVVGESMVALTISCAILDKFGGDSLCEIKRNFSGYLNSIPKNLMSVIER

aroC

Chorismate synthase

399 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.944 kDa

MLRWTTAGESHGRALVAMLEGMVAGVPITSEEIGAQLKRRRLGYGRGARMKFEQDQVTMLAGVRHGLTLGGPIAIEIGNTEWPKWESVMSPDPVDPADLDVARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTVARAFLREALGVEVLSHVISIGASKPYDGPAPQFSDLSAIDDSPVRAFDKASEELMIAEIEAAKRDGDTLGGVVEVVADGLPVGLGSFTSGENRLDSQLAAAVMGIQAIKGVEIGDGFETARRRGSVAHDEMYPGPDGVVRSTNRAGGLEGGMTNGQPLRVRAAMKPISTVPRALATVDMTSGEEAVAIHQRSDVCAVPAAGVVVETMVALVLARAALEKFGGDSLAETRANIDSYLRAVAEREPAAQASS

aroC

Chorismate synthase

399 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.895 kDa

MLRWLTAGESHGPALVGIIEGVPAGVELTSSQIADALARRRLGYGRGARMKFEQDVVTVLGGVRHGITQGGPVAIQVGNTEWPKWEQIMAADPVAPEILADQARNAPLTRPRPGHADFTGMQKYGFDEARPVLERASARETATRVALGTVASQFLKQLGIELVSHTVSIASVSVPEGRPLPVPANVIALDADPLRCFDRETSDAMVAEVDAAHKEGETLGGVVEVLAYGLPPGLGSYVHWDRRLDSRLAAALMGIQAIKGVEVGDGFLTASRRGSAAHDEIVKDSDGRIIRTSNRAGGIEGGMSIGDVLRVRAAMKPIATVPRALKTIDVSTGEAAKAHHQRSDVCAVPAAGVVAEAMVALVLAEAVAEKFGGDSVAETARNIKGYLDNIPASLDSIGQ

aroC

Chorismate synthase

399 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.284 kDa

MIQYVTAGESHGPALSAIVDGMPAGVPLTDEAINHQLARRQQGYGRGGRMKIETDKAEVLSGIRFGKTIGSPIAMVIRNRDWQNWTTTMAQFEQPQEAIPAITVPRPGHADLAGCIKYGFEDIRPVIERSSARETAARVAAGACAKLFLKALGIEIGSIVTAIGSAKEEMPQQELAAMLAHGAEAVATQADQSPVRMLSKSAETAAIAAIDEAKANGDTVGGIVDVFITGVPLGFGSYVQHNRRLDADLAAALLSIQAIKGVEIGTAFDNACKYGSQVHDEFIFSESGELTRPTNRAGGIEGSMSSGQVIHLRAAMKPISSLISPLQSFDIASMEPIPSRFERSDTCAVPAAGVVAEAVVAPVIANALLAKLGGDHFSEIHERLEAYRAYLANRLQRKS

aroC

Chorismate synthase

399 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.115 kDa

MLRWLTAGESHGPALMGIIEGVPAGVEITSGHIADSLARRRLGYGRGARMKFEQDVVTILGGVRHGVTQGGPVAVQVGNTEWPKWEQIMAPDPVDPELLADQARNAPLTRPRPGHADFTGMQKYGFDEARPVLERASARETATRVAMGTVAAQFLKHLGIELVSHTVSIASVSVPDGRPLPEPADVIALDADPLRCFDRETSDAMVAEVDAAHKEGETLGGVVEVLAYGLPPGLGSYVHWDRRLDSRLAAALMGIQAIKGVEVGDGFRTAARRGSAAHDEIVRDEDGRIVRASNRAGGIEGGMSIGDVLRVRAAMKPIATVPRALKTIDVSTGEPAKAHHQRSDVCAVPAAGVVAEAMVALVLAEAVTEKFGGDSVAETARNIKGYLDNIPASLDSIGQ

aroC

Chorismate synthase

399 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.362 kDa

MNGNEFGRLFRMTTYGESHGEAMGCTVSGVPAGVELSEEEIQKDLDRRKPGQSMITTSRGEPDKVTINSGIQDGYTTGTPIGMVIQNKDARSGKYEPFITAPRPSHGDYTYSAKFGTRNWGGGGRSSARETVNWVAAGGVAKQVLEQSDYDVQIKAHVCQIGDVEAGPVTFEDMLEHSEENEVRCADPEAAEEMRDVADQHQKEGDSIGGAIYFECRGVPSGLGAPRFDSFPSRLGQAMYSIPAVNDFEYGIGREARTTKGSEYTENWEFDEDGHPTPVGNDHGGIQGGITTGQPIYGEVSWHAPVSIPKTQETVDWETGEGKEITVTGRHDPVLPPRAVPVVEAMLACTVLDFMLLGGRINPDRLDGRPGEYDTDYHPSSPQNDPEDADTHAKTIDDD

aroC

Chorismate synthase

398 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

44.254 kDa

MSLRYLRFLTAGESHGKGLTAILEGIPANLPLSEEEINHELRRRQRGYGRGGRMKIEKDTAEILSGVRFGKTLGSPIALFIRNRDWENWKEKMAIEGEPSPSVVPFTRPRPGHADLSGGIKYNQRDLRNILERASARETAARVAVGAVCKKFLSEFGIKIGSFVVSIGQKEVEELKDKSYFANPEKLLSYHEKAEDSELRIPFPEKDEEFKTYIDEVKEKGESLGGVFEVFALNVPPGLGSHIQWDRRIDGRIAQAMMSIQAIKGVEIGLGFEAARRFGSQVHDEIGWSEGKGYFRHSNNLGGTEGGITNGMPIVVRVAMKPIPTLKNPLRSVDIETKEEMKAGKERTDIVAVPAASVVGEAMLAIVLADALLEKLGGDFMEEVKKRFEDYVNHVKSF

aroC

Chorismate synthase

398 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.931 kDa

MLRYLTAGESHGPALVATMEGIPAHVQVGAVEISEELRRRRLGAGRGARMSFEADELELLAGFRHGETLGDPLAIRIGNSEWEKWRTVMAPGPVAPEDLAGHARAAALTRPRPGHADLAGMQKYDFDEARPILERASARETAARVALGAIAKAFLKQSLGIEVLSHVVSLGPVSAPNGPRPDPSDLTRIDADPVRCADSVTSKRMVAEIEACRKEGDTLGGVVEVLAYGLPAGLGSHSQGDRRLDARLAGALMGIQAIKGVEFGDGFDLTRRRGSQAHDWMEPTEGGIHRVSDRAGGTEGGMSTGQILRVRAAMKPIATVPRALPTVDVTTGEAANAHHQRSDVCAVPAAGVVAEAMAALVLAECALEKFGGDSVTETRRNAQAYLDRLAARGLAVAP

aroC

Chorismate synthase

397 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.326 kDa

MIRYFTAGESHGPALSAIVEGMPAGISIAPEDINDELARRQRGYGRGGRMNIETDTAAVLSGIRFGKTIGSPITLQIENRDWKNWTVKMAQFEQPEENIPAITIPRPGHADLTGMIKYGFQDIRPVIERASARETAARVAACSLAKVFLRHAGIQIGSYVSAIGPAGEIAPSPKMQELLSQGAASLSRAADASCVRMLDKENEEAAIAAIDKAKEDGDTLGGIIEVFITGVPLGLGTYVQHDRRLDAALAAALLSIQAVKGVEIGSAFDNARRPGSQVHDEMYVEDGSAPVRKTNRAGGIEGSMSNGQVIHLRAAMKPIATLMSPLHSFDLSSMEAHLSHIERSDTCAVPACSVIAEAVVAPILANALLEKTGGDHLEEILERLNAYKASIAKQFQT

aroC

Chorismate synthase

397 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.456 kDa

MLRWQTAGESHGEALVAMIEGLPAGIHVTTEDIVGALARRRLGYGRGARMKFEQDKVRMLTGVRFGETIGSPVAIEIANTEWPKWTEVMSADPLDHDIPREGRNAPLSRPRPGHADLTGMRKYGFDDARPVLERSSARETASRVALGEVAKQFLEQTLGIRTVSHVLSIGGAGITDPQNAVLPKPEDLEALDASPVRTLDKTAEQQMIARIDEAKENADTLGGVIEVVVYGVPAGIGTYVESDRRLDAALASAVMGVQAIKGVEIGDGFLEAMRPGSQAHDEMAVGDDGRITRLSNRAGGIEGGMSNGQPIVVRAAMKPIPSIPKALRTVDVTTGEAAQAINQRSDNTAVPAAAVVAEAMVRLTIAQYVLEKFGGDSVAETKRNAESYVASWPEHMR

aroC

Chorismate synthase

397 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.492 kDa

MIRYFTAGESHGPALSAIVEGMPAGITITPKEINTQLARRQQGHGRGGRMKIESDKAEILSGVRFGKTIGSPITLVINNRDWQNWTTTMAQFEKPDEQCSKITIPRPGHADLAGRIKYGFDDIRPVIERSSARETAARVAAGTVARLFLKALGIEIGSYISAIGSAAEASPDKQLEGLLLEGAEAVARQADLSPVRMLGKETETNALAAIDGASERGDTLGGIIEIFITGVPPGFGSYVQHDRRLDAALAAAIISIQAIKGVEIGTAFENARKPGSEVHDEFHLSREKGVIRKTNRAGGLEGSMSSGQTIHLRAAMKPISSLVTPLLSFDVETLQATPSRFERSDTCAVPAAGVVAEAVLAPVIANALLEKLGGDHLDEIRQRLDLYRESIRSTFHS

aroC

Chorismate synthase

396 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

44.186 kDa

MVLRFITSGESHGKGLIGIVEQMPAGVEIGEEDINRELQRRQKGYGRGGRMKIESDRVEIFSGIRNGYSLGTPISYLIRNQDFENWQEIMATGECKRHEEKIVNRPRPGHADLAGAMKYNQSDMRNILERASARETAARVAAGAMFKKLLESFNIRVYSQVKSIGPVQVKTWQVNEQNWQDLREKVDESPLHSVDTEKEPLMREAIDQARSKGESLGGSFEVGVIGVPPGLGSYISWESRLDSQICALLMSIPAIKAAEIGEGIANSAEPGSRVHDEIFYSEEGGLHRKSNRAGGIEGGISNGETVWARAYMKPIPTLYKPLTSVNTKLWQEEKADIERSDICAVPAAAIVGESMLAFAIARAFLEKFSGDSLDEIRKSYTTYQAYLKRVWKWEKI

aroC

Chorismate synthase

396 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.181 kDa

MLRWQTAGESHGEALVAMIEGMPSGVRVTSQDIRDALARRRLGYGRGARMKFEQDQVRLLTGVRFGSTLGSPIAIEIGNTEWPKWTEVMSADPLDHELAREGRNAPLSRPRPGHADLTGMRKYGFDDARPVLERSSARETASRVALGEVAALFLEQVAGIRTVSHVISIGGAGVESDNTPLPGPDDVAALDASPVRTLDKDAEERMVARIDEAKAKADTLGGVIEVIAYGVPAGIGTYVESDRRLDAALAAAVMGIQAIKGVEIGDGFLEAGRPGSMAHDEMVPGDDGCIARLSNRAGGIEGGMSNGQPIRVRAAMKPIPSIPRALRTVDITTGEAAQAINQRSDSTAVPAAAVVAEAMVRLTLAQHLLEKFGGDSIEETRRNIEGYLASWPEHMR

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.143 kDa

MLRWLTAGESHGPALVAVLEGLPAGVEITTTQIGDALARRRLGYGRGARMSFERDEVRLLGGVRHGLTQGGPIAVEIGNTEWPKWETVMAADPVDPAALTGARGAPLTRPRPGHADLIGMTKYGFDEARPVLERASARETASRVALGRVAAAFLEQAAGVRLVSHVVAIGPVSAPDDADLPTPDDVAALDADPIRCFDAATSAAMVAEIDDAQKAGDTLGGVVEVLAYGLPPGLGSYVQSDRRLDGRLAGVLMGIQAIKGVEVGDGFRTAARRGSAAHDEIERATDGRVRRRTNRAGGVEGGMTNGEVLRVRAAMKPISTVPRALDTIDTATGDAAKAIHQRSDVCAVAPAAVVAEAMVALVLAQALLEKVGGDSVAESARNLTSYLEAIPEQQR

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.363 kDa

MLRWQTAGESHGEALVAMIEGLPAGVRISTDDIVSALARRRLGYGRGARMKFEQDKVRLLTGVRHGLTLGSPVAIEIANTEWPKWTEVMSADALDHDLPREGRNAPLSRPRPGHADLTGMRKYGFDDARPVLERSSARETASRVALGEVAKQFLDQAFGIRTVAHVVALGGVQTNPDLPLPTPDDLEALDASPVRTLDKEAEARIIERINEAKKASDTLGGVIEVLAYGVPAGIGTYVESDRRLDAALASAIMGIQAFKGVEIGDGFLEASRPGSQAHDEIVVNADGRIDRLSNRAGGIEGGMSNGQVIRVRGAMKPIPSIPKALRTVDVLTGESAQAINQRSDSTAVPAASVVAEAMVRLTLAKYALDKFGGDSVAETRRNLESYLASWPEHMR

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.363 kDa

MLRWQTAGESHGEALVAMIEGLPAGVRISTDDIVSALARRRLGYGRGARMKFEQDKVRLLTGVRHGLTLGSPVAIEIANTEWPKWTEVMSADALDHDLPREGRNAPLSRPRPGHADLTGMRKYGFDDARPVLERSSARETASRVALGEVAKQFLDQAFGIRTVAHVVALGGVQTNPDLPLPTPDDLEALDASPVRTLDKEAEARIIERINEAKKASDTLGGVIEVLAYGVPAGIGTYVESDRRLDAALASAIMGIQAFKGVEIGDGFLEASRPGSQAHDEIVVNADGRIDRLSNRAGGIEGGMSNGQVIRVRGAMKPIPSIPKALRTVDVLTGESAQAINQRSDSTAVPAASVVAEAMVRLTLAKYALDKFGGDSVAETRRNLESYLASWPEHMR

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.317 kDa

MLRWQTAGESHGEALVAMIEGLPAGVRISTDDIVSALARRRLGYGRGARMKFEQDKVRLLTGVRHGLTLGSPVAIEIANTEWPKWTEVMSADALDHDLPREGRNAPLSRPRPGHADLTGMRKYGFDDARPVLERSSARETASRVALGEVAKQFLDQAFGIRTVAHVVALGGVQTNPDLPLPTPDDLEALDASPVRTLDKEAEVRIIERINEAKKAADTLGGVIEVLAYGVPAGIGTYVESDRRLDAALASAIMGIQAFKGVEIGDGFLAASRPGSQAHDEIVVNADGRIDRLSNRAGGIEGGMSNGQVIRVRGAMKPIPSIPKALRTVDVLTGESAQAINQRSDSTAVPAASVVAEAMVRLTLAKYALDKFGGDSVAETRRNLESYLASWPEHMR

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.662 kDa

MNGNRFGRLFQVTTYGESHGEAMGVTVSGVPAGVELDEEAIQAQLDRRKPGQSMITTSRGEPDEVVVNSGVQDGYTTGTPIGMVIQNKDARSGKYEPYVTAPRPSHGDYTYSAKFGTRNWGGGGRSSARETVNWVAAGAVAEQVLDASEYDVEIKAHVNQIGDVEADDVSFEQILDHSEENDVRCADPEAAAEMQELIERYQEAGDSIGGSIYFECRGVPRGLGAPRFDGFPSRLGQAMFSIPATTGVEFGLGKDAVNVTGSERNEDWTFDDGESFDHVESEEGDPVPVGNDHGGLQGGITTGEPIYGEATWHAPTSIPKKQRSADWETGEEKDVQVVGRHDPVLPPRAVPVVEAMLYCTVLDFMLLAGRINPDRVDGNPGQYDTDYHPSSPDND

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.639 kDa

MLRFLTAGESHGPGLTIIVEGIPADLPLLAEDIDRDLARRQVGFGRGGRMSIETDRVTFRGGVRLGRTIGSPIAMTLENRDFKNWEVPMSVSPVDLDDEAVRAQLEAKRITRLRPGHADYPGAVKYGLADVRNILERSSARETASRVAAGAIAKQLLRQFNVHVHSHVVEIGGVGAGESVRPALPTFEEWKDLFERVDQNDLRCHPDLYERLRSRVVEAAKGGYTLGGAVELAAYGEIPVGLGSHVHYDRRIDGLLAGAAMSVHTVKAVEVGIGTAAARETGADVQDEFINAAGEIARTSNHAGGIEGGMTNGQPVLLRAYLKPLPTMRKALRSIDLVSREPFEAHYERSDTCAVPAGGVVCEAMMAIVLAQELQRKLGGDSLGEMLRHAGRTHA

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.378 kDa

MLRWITAGESHGPALVAMLEGMVAGVEVTSEDISTQLARRRLGYGRGARMKFEADKVTIVGGVRHGRTLGGPIAVEVGNTEWPKWETIMSADPVDAELLADQARNAPLTRPRPGHADYSGMLKYGFDDARPVLERASARETAARVAAATFARSFLRQVFGVEVLSHVISIGASDPYVGPEPTASDLAAIDASPVRAFDKAAEESMIAEIEAAKRDGDTLGGVVEVVIHGLPVGLGSFISGADRLDARLASALMGIQAIKGVEVGDGFETARRRGSQAHDEMRPGPDGILRSTNRAGGLEGGMTNGEALRVRAAMKPISTVPRALATVDMSTGEEAVAIHQRSDVCAVPAAGVVAEAMVALVVAQAALEKFGGDSVAETTANYERYASGVAARLAR

aroC

Chorismate synthase

395 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.29 kDa

MLRWITAGESHGPALVAMLEGMVAGVEVTSEDISTQLARRRLGYGRGARMKFEADKVTIVGGVRHGRTLGGPIAVEVGNTEWPKWETIMSADPVDADLLADQARNAPLTRPRPGHADYSGMLKYGFDDARPVLERASARETAARVAAATFARGFLRQVFGVEVLSHVISIGASDPYAGPEPTASDLAAIDASPVRAFDKAAEESMIAEIEAAKRDGDTLGGIVEVVIHGLPVGLGSFISGADRLDARLASALMGIQAIKGVEVGDGFETARRRGSQAHDEMRPGPDGILRSTNRAGGLEGGMTNGEALRVRAAMKPISTVPRALATVDMSTGEEAVAIHQRSDVCAVPAAGVVAEAMVALVVAQAALEKFGGDSVAETAANYERYASGVAARLAR

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.162 kDa

MVRWLTAGESHGPALVATVEGLPAGIRVTSDDIAAELARRRLGHGRGARMSFERDVVELLGGLRHGVSLGGPISVVVRNSEWPKWERVMSPDPVDPAALAGLGRNAPLTRPRPGHADLAGMQKYGFDDARPVLERASARETAARVALGTAAKALLRQAYGIELLSHVVAIGAAEVPPGLPAPTSLAAIDANPVRCADQATSERMVAEIDAAQADSDTLGGIVEVLAYGCPPGLGSYVHGDRRLDARLAGELMGIQAIKGVEFGDGFTTARRRGSVAHDEIEPVGGVGRRVRRATDRAGGVEGGMTTGEPLRVRVAMKPISSLTRPLSTVDVTTGEAAVAINQRSDVCAVPAAGVVTEAMVALVLADAALEKFGGDSVEETRRNCEGYLKSLVIH

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.144 kDa

MVRWLTAGESHGPALVATVEGLPAGIRMTSSDISAELARRRLGHGRGARMSFERDEVELLGGVRHGVTLGGPVSVVVRNTEWPKWERVMSPDPVDPAALAGLGRAAPLTRPRPGHADLAGMQKYGFDDARPVLERASARETAARVALGTAAKALLRQAYGIEVISHVVAIGAVEVPPGVPAPTSLAAVDADPVRCADQATSVRMVAEIDVAHADADTLGGIVEVLAYGCPPGLGSYVHGDRRIDARIAGELMGIQAIKGVEFGDGFTTARRRGSGAHDEIEPAGAGSRRVRRATDRAGGVEGGMTTGEPLRVRVAMKPISSLTRPLSTVDVSTGEAAVAINQRSDVCAVPAAGVVTEAMVALVLADAALEKFGGDSVEETRRNYEGYLKSLVIR

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.249 kDa

MVRWLTAGESHGPALVATVEGLPAGIRVSSTDIGAELARRRLGHGRGARMKFEQDEIELLGGLRHGVSLGGPVSVVVRNTEWPKWERVMAPDPIDPAELEGLGRNAPLTRPRPGHADLAGMQKYGFDDARPVLERASARETAARVALGTVARALLRQAYGIEVVSHVVAIGAVEVPPGTPPPTSLAVVDADPVRCADPASSALMVAEIDAAHRDADTLGGIVEVLAYGCPPGLGSYVHGDRRLDARLAGELMGIQAIKGVEFGDGFRTARRRGSVAHDEIEPLEGPGRRVRRASDRAGGVEGGMTTGEPLRVRAAMKPISSLSKPLATIDVATGDPAVAIAQRSDVCAVPAAGVVAEAMVALVLAGAALEKFGGDSVEETRRNYEGYLKSLAVR

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.644 kDa

MSRLRWLTAGESHGPALVATLEGLPAGVPITTDMVADHLARRRLGYGRGARMKFERDEVTFLGGVRHGLTLGSPVAIMVGNTEWPKWEQVMAADPVDPAILADLARNAPLTRPRPGHADLAGMQKYGFDEARPILERASARETAARVALGAVARSYLKETAGIEIVSHVVELAAAKAPYGVYPTPADVEKLDADPVRCLDADASKAMVAEIDQAHKDGDTLGGVVEVLAYDVPVGLGSHVHWDRRLDARLAAALMGIQAIKGVEVGDGFELARVPGSKAHDEIVQTADGVRRTTGRSGGTEGGLTTGELLRVRAAMKPIATVPRALATIDVATGEATKAHHQRSDVCAVPAAGIVAEAMVALVLADAVAEKFGGDSVPETRRNVRSYLDNLVVR

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.577 kDa

MSRLRWLTAGESHGPALVATLEGLPAGVPITTEMVADHLARRRLGYGRGARMKFERDEVTFLGGVRHGLTMGSPVAVMVGNTEWPKWEQVMAADPVDPEVLAGLARNAPLTRPRPGHADLAGMQKYGFDEARPILERASARETAARVALGAVARSYLKETAGVEIVSHVVELASAKAPHGVYPTPADVERLDADPVRCLDADASKAMVAEIDQAHKDGDTLGGVVEVLAYGVPVGLGSHVHWDRKLDARLAGALMGIQAIKGVEIGDGFELARVPGSRAHDEIVGTPDGIRRVSGRSGGTEGGLTTGELLRVRAAMKPIATVPRALKTVDVATGEAAQAHHQRSDVSAVPAAGIVAEAMVALVLADAVAEKFGGDSVTETRRNVRSYLDNLDIR

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.155 kDa

MVGNTFGRIFRVTTCGESYAGAFRKNLQIPKELFGGLIAIVDGVPPGIKLTADFVQEELDKRRPGKTPLDTPRKERDKVYIFSGVMEDDITTGAPVGMIIPNDVIEDEHINKHKSYKEVVRPGQAGYTFFKKYGQFADNIGAGRASGRETAARVAAGAVAKAVLDTMGIDVIAFVTEIHGIKAQENITYEMAKANYRKNEINCPDLEKAKEMIEELKRIKEEGDSVGGVVEIIARGVPAGLGEPVFDKLQATLAHALMSIGAIKGIEFGEGFGHTKLKGSESNDVPYYDEASGRVRFKTNRAGGILGGISNGEDIRIRVAVKPTPTISIPQKTVNMYTLENVEVEFNTRNDPSICPRIYPVCEAMVRIALLDALYIAKGYRAISSNIDPRWDRL

aroC

Chorismate synthase

394 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.42 kDa

MNGNRFGRLFEVTTYGESHGPGMGVVVSGCPAGVALDERMIQDELDRRKPGQSMITTSRGEPDEVSIQSGLQDGYTTGTPIGMTIENKDAESGKYEPFVTAPRPSHGDYTYSAKFGTRNWGGGGRSSARETVNWVAAGAVAKAVLAQSDHDVRVKAHVNQIGEIEAPDVSFEDIREHSEDNEVRCADPETAERMRALIDDYQERGDSIGGSIYFEARGVPRGLGAPRFDSVPARLGQALFAIPATTSVEFGLGRDARSVAGKQRNEDWTVADGDEDHVVADEGDPIPAGNDHGGLQGGITTGEPIYGEASWHAPTSIPKTQATVDWETGEEKAVTVTGRHDPSLPPRAVPVVEAMLYCTILDFMLLGGRINPDRLDGHPGQYDTDYHPSSPRNE

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.575 kDa

MLRFQTAGESHGEALVATLTGVPAGLPIDQAFLDRELWRRQQGFGRGGRMKIERDTAHILSGVHHGKTIGSPIAILIRNNDWKNWQESLPVEEGDSAKHKPVKSPRPGHADLAGALKYNFPEARYVLERASARETTARVAAGAIAKLLLRQIGADVLSHVIAVGTARLENTEVQWEKLVELAQRDNVLLGCVDPEAEQRMKEQVDQVLRTGDTVGGVFEVVAHNLPPGLGTYVEWDRRLDGLLAMAVMSLQAVKAVEIGEGVSVAATFGSGAQDEIGYEREHESKFTGFTRTSNHAGGIEGGVSNGQDILVRGYLKPISTLRRPLGSVDFATREPLKAAYERSDVCVVPAAGIAAEAMVAITLAGCALEKFGGDSLVEFKRNYEGYCQQLQSF

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.518 kDa

MLRWLTAGESHGPALVAILEGLPAGVSVTSDDIAAALLRRRAGYGRGARMKFEKDEVSIIGGIRHGRTLGGPVAIQVGNTEWPKWQKVMSPDPVPAEELEGVARNAPLTRPRPGHADLVGMQKYGYDEARPILERASARETAARVALGEVARQFLRQALGVEIVSHVVAMGSVSVPDDAPIPAPEDLARVDADPVRCFDPETSARMVAEVDDTRKTGDTLGGVVEVIAYGLPPGLGSHVHWDRRLDARLAGALMGIQAIKGVEFGDGFRTAARRGSAAHDEIDVGPDGIRRRSNRAGGVEGGMSTGDPLRVRAAMKPIATVPRALDTIDVSTGQPAQAHHQRSDVTAVPAAGVVAEAMVALVLADAALEKFGGDSVAETVRNLRGYLDSLIVR

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.38 kDa

MLRYLTAGESHGPQLTAIIEGMPAGVPLLAEDINRELARRQQGYGRGDRMKIEKDQVEILSGVRWGETLASPLTLVVKNRDWENWSTKMSSLPEFRDESQAVTRPRPGHADLGGALKYGHRDLRNILERSSARETAVRVAVGAAAKALLRLFGIRVGGVVREVGGVVATDPAASFEYIWASAGQSPLFCCDGAAEQEMKRLIDDAKGSGDTLGGVVEVQVIGVPPGLGSHVQWDRKLDARLAMALMSIQAIKGVEVGIGFETARRPGSQVHDEIFRDAARTGADSGGAYYRTSNNAGGIEGGMSNGEAIILRAAMKPIPTLYKPLRSVDMLTHEPFQAAVERSDTCAVPAALVVAEAVVAVEIANAFLEKFGGDSVQEIRRNYQGYCERIRTL

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.7 kDa

MRYLTAGESHGPQLTTIIEGLPSLLPITAEKINHDLKRRQGGHGRGRRMQIETDTVEIVAGVRHGQTLGSPVALVVANDDWKHWTKIMGAEPLAEDVNPEDIKRQISRPRPGHADLVGGMKYGHRDLRNVLERSSARETTVRVAVGSVAKALLNELGISIVAHVTEIVGIKADTSLVEGKTVDEIRAIVEADPCYCVDPVASAKMVDAIDEAKKAGDSIGGVVEVIVEGMPAGIGSYVHYDRKLDAKLAAAMLSINAFKGVEFGLGFEMARRKGSEVHDEIIWTEEEGYTRATNRLGGLEGGMSTGMPIVVRGVMKPIPTLYKPLQSVDIETKEPFKASVERSDSCAVPAASVVAEHVIAWEIATVILEQFHSDQLPQLKAQIDEHRQYTKGF

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.832 kDa

MFRYLTAGESHGPQLTAIIEGIPAGLKLSEESINVDLARRQGGYGRGGRMAIEKDQVEILSGVRWGKTIGSPITLCVKNRDWTNWQEKMSPQERFRDDNIHVTRSRPGHADLPGAMKYDHKDVRNILERSSARETAVRVAVGSVAKALLQHFEIYLCGYVAELGGIKAKRPELCPAELRATIAKSELYTCDSAVEGEMKKLIDEVKAAGDTVGGVVEVIASGVPAGLGSHVQWDRKLDARIAMAMMSIQAFKGVEIGLGFEAAARKGSNVHDEIFYDQSRASQGSMTGYYRLTNNAGGIEGGITNGEDILVRAAMKPIPTLYKPLRSVDIVSKEPFEATVERSDVCAVPAASVVAESVLAIELADAFMVKFGGDSIEEMQRNYAGYLEYLKNF

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.697 kDa

MLRYLTAGESHGPQLTAIIEGIPAGLKISEETINVDLARRQGGYGRGGRMLIEKDQVQILSGVRWGETIGSPVTLCVVNRDWVNWQEKMSPHERHRDDKIRVTRSRPGHADLPGAMKYNHRDVRNILERSSARETAMRVAVGSVARAFLASFGVTVSGFVVELGGIKAERRGLSSDRLRELAAKSELATYDPEAEARMKAFIDSVKDAGDTAGGVVEVVVTGAPVGLGSHVQWDRKLDARLAMAVMSIQAIKGVEIGLGFETARRPGSQVHDEIYFDSSRIAHGEATGFFRKTNNAGGIEGGITNGEEIVIRAAMKPIPTLYKPLSSVDMLTKEPFEATVERSDVCAVPAAAVVAESVVAIEIASAFLEKFGGDSLAEIRRNYDGYLDYLRSF

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.014 kDa

MLRYLTAGESHGPQLTAIIEGLPAGLKISDESINCDLARRQCGYGRGGRMKIERDEAQILSGVRWGETIGSPVTLCIVNRDWINWQEKMSPNARHRDEKIRVTRSRPGHADLPGAMKYDHRDVRNILERSSARETAVRVAVGAVAKAFLASFGIEVNGFVSEVGGIRAERRSLQLERMKELSAASELFTYDAEAEERMKAFIDGAREAGDTVGGVVEIIASGLPVGLGSHVQWDRKLDARLAMAVMSIQAIKGVEIGLGFDAARRPGSQVHDEIYYDSTRISRGELSGFYRKSNNAGGIEGGITNGEDIVIRAAMKPIPTLYRPLRSVDMQTKEPFEATVERSDVCAVPAAAVVAEAVVALELANAMLEKFGGDSLGEVRRNYEGYLEYVRAF

aroC

Chorismate synthase

393 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.994 kDa

MFRYLTAGESHGPQLTAIIEGIPAGLSLSEEQINIDLARRQCGYGRGGRMLIEKDQVEILSGVRWGKTIGSPITLCVRNRDWENWHEKMSPHERFHDDKIRVTRSRPGHADLPGAMKYNHHDVRNILERSSARETAVRVAVGAVAKALLSQFEIEVCGFVAELGGIKAIRPSLPLAALKDMAAKSELFTYDKSVEEEMKRLIDTVRDEGDTVGGVIEVNAVGVPPGLGSHVQWDRKLDARLAMAVLSIQAFKGVEIGIGFQAAASTGSKVHDEIFYDSARIAHGEQSGFYRKSNNAGGIEGGISNGEEIVVRAAMKPIPTLYKPLRSVDIVSKEPYEATVERSDVCAVPAASVVAEAVVAIELADAFMVKFGGDSITEIKRNYQSYLDYLRAF

aroC

Chorismate synthase

392 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.154 kDa

MLRWLTAGESHGPALVALLEGVPAGVEVTTEEIAGELARRRLGYGRGARMAFEQDEIEIIGGLRHGVTLGSPVAIRVGNSEWPKWRTVMAPDPVDSTELAGQARNAPLTRPRPGHADLAGMQKYGHTDARPILERASARETAARVAVGTVAKALLRQALGIEVVSHVVELGTVATKPGLRPSPADGDRIDADPLRCLDPEASVRMVAEVDAAKKDADTLGGVVEVLAYGVPPGLGSHVQWDRKLDARLATALMSIQAIKGVEIGDGWQQARSRGSVAHDEIIPTATGVRRVTDRAGGLEGGITTGEPLRVRAAMKPISSLNRALSTVDITSGEPATAINQRSDVCAVPAAGVVAEAMVALVLAEAAVEKFGGDSVVEQRRNLAGYLDALVVR

aroC

Chorismate synthase

392 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.773 kDa

MRYTTAGESHGPEEIAVIEGIPAGLHITQEDVNAQLARRQKGYGRGERQKIETDTVTFLTGIRHQKTLGSPITLNVHNDDHNNWSKIMAPNEPQTSENSLRKVLRPRPGHADLVGGIKYRHHDDLRNVLERSSARETTMRVAVGAVAKKLLAEIGVDVHGFVVNVGPAKSDLSTLTQYQDLEALRQVTESFETRALDAAADKAIRDVIDSTKRDANTVGGQVQVMATGVPVGLGSYISADDKLDAKIARAIVGINAFKGVQFGGGFDNAEKYGDQVMDEIFWRPEKGFYRGSDNLGGFEGGMTTGEAIVVRGVVKPIPTLYRPMQSVDIDTHQDHRASIERSDTTAVTAAAVIAEAMVAIELAKAVLDKFDADNIDRMKEQVAAYRQEVKAF

aroC

Chorismate synthase

392 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.039 kDa

MRYVTAGESHGPEEIAVIEGIPAGLHISQEDVNEQLARRQRGYGRGERQKIETDTVTFLTGVRHQTTLGSPITLNVHNDDHNNWSKIMAPNEPATAENTLRKVLRPRPGHADLVGGMKYRHREDLRNVLERSSARETTMRVAVGAVAKKLLSEIGVDVHGFVVNVGPAKSDLNELTKYKNLQELRVVTEGFDTRALNAEADEAIKEVIDKTKRDANTVGGQVQVIATGMPVGLGSYVSADTKLDAKIANAIVGINAFKGVQFGGGFDNAEKYGDQVMDEIFWDEERGFYRGSDNLGGFEGGMTTGEAIVVRGVVKPIPTLYRPMQSVDIDTHEDHRASIERSDTTAVTAAAVIAEAMVAIELAKAVLDKFDADNIERMKEQVAVYREEIRKF

aroC

Chorismate synthase

392 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.466 kDa

MRYITAGESHGPQLTAIIEGLPAGLEISPEMLDLQLARRQQGYGRGDRMKIERDRADILSGVRWGKTLGSPVTLVVKNRDWENWLEKMSPLAEHEGQAEAVTRPRPGHADLCGAMKYGHRDVRNILERSSARETAVRVAVGAVARGLLHALDIRIGGVVVEVGGVAAKPSAEPYPQQWAQAAASEMFCCDPAAELDMKRLIDHTKSIGDTLGGVVEVQVLGLPPGLGSHVQWDRKLDARLAMALMSIQAIKGVEIGLGFEAARRPGSKVHDEITWNPARLQQGELTPYQRPSNHAGGLEGGMTNGEPLVVRAAMKPIPTLYTPLQSVDIATHEPYEASVERSDTCAVPAALVVAEAVVAIELAQALLEKFGGDSLDEIRRNRDNYLAGLRDF

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.179 kDa

MPGNSFGKLFRITTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYDEIKYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVSRVIAGAVAKKLLMLTDTWIAGHLRSLGPEELSEEVTFEEVLCSKYSPVRASKKDLEEKYEALIKKATQEGDSYGGIAEVIAKNPPIGLGEPVFDKMKAELAKAIMSIPAVMGFEYGLGFIASKMKGSEANDEIIRKNNRIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEESYISVIGRHDPAVAIRGVTVVESMVALTIVDHAMRAGAIPLVKLTEDQANTIQQRWERYVKSCKPMEESQS

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.085 kDa

MPGNSLGKMFRITTFGESHGPMIGVIVDGVPAGLYISKEDIEFELSFRRPGKQFVSGRREKDEPEIVSGVYNGRTTGAPLTIIIRNNDVISSLYEEVKHKPRPGHADLPYIMKYGYENWDYRGGGRSSARETASRVAASAIAKKLLMLTDTVIGAHLKSLGPVELDEDVSFREIFCSKYSPVRASKKWLEEKYEELIKQATVEGDSWGGVAEVIADNVPIGLGEPVFDKLKSDLAKALLSIPAVVGFEYGLGFKASKMKGSEANDEIVIKDNGKLGWRYNKAGGILGGLSNGEKLVLRCAFKPTSSIRKPQKTVDLRTSEESTIRVIGRHDPAVAIRGVSVAEAMVALVLVDHALRSGYIPPVKLSEDQARIIEEKWRRYVEECKPMQESQ

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.257 kDa

MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVVSSFYEEIRYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYSPVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMSIPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIPLVKLTEEQGNIVQQRWERYVRSCKPMEESQL

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.271 kDa

MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYEEIRYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYSPVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMSIPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIPLVKLTEEQGNIVQQRWERYVRSCKPMEESQL

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.271 kDa

MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYEEIRYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYSPVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMSIPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIPLVKLTEEQGNIVQQRWERYVRSCKPMEESQL

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.271 kDa

MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYEEIRYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYSPVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMSIPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIPLVKLTEEQGNIVQQRWERYVRSCKPMEESQL

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.243 kDa

MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRKPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYEEIRYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYSPVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMSIPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIPLVKLTEEQGNIVQQRWERYVRSCKPMEESQL

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.271 kDa

MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRRPGRLYVSGRREKDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYEEIRYKPRPGHADLPFIMKYGYENWDYRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYSPVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMSIPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAFKPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIPLVKLTEEQGNIVQQRWERYVRSCKPMEESQL

aroC

Chorismate synthase

391 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.732 kDa

MRYLTAGESHGRALVTIVEGLPAGVPVDLAAIDRDLARRQSGYGRGGRMKIEQDRVQVLSGIRHGKTLGSPVALLVENRDWLNWTEVMSPAPLEAYTDPRAAQKVRTRPRPGHADLAGALKYDHADLRNVLERASARETAARVAAGSLAKQYLAPFGIRVAGYVRSIGPVEAQPPAGLDLDGIVARAEASPVRCPDPAASARMVEEIDAAKRDGDSLGGVVEVVAAGLPPGLGSHVHWDRKLDGALGAALLSIQAAKGVEIGDGFLGARRRGSEVHDEIGWSPDRGYFRYTNRAGGLEGGMTNGMDLVVRVAFKPIATLYKPLRSVEIDTHVEAAAGIERSDVCAVPAAAVIAECVTAFELARFVAEKFGGDSLEEALRNFRGYLEQIARR

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.87 kDa

MLRYLTAGESHGPALITIVEGLPAGLAVEAGYVDRQLARRQGGYGRGKRMAIEQDRVRILSGVRGGLTLGSPVCLQIENRDWENWSTTMAPGPEADTGDRVVTRPRPGHADLAGVLKYGHKDVRNVLERASARETAARVAAGSLARRLLEELGVEILGLVVRIGPVQARIPEVPLDALRARIAESRVMCPDPYAGLSMVEEIDRARDDGDSLGGVFELHAFGVPPGLGSYVQWDRRLDGRLAGALMSIQAVKGVEIGLGFEGAAQRGSEVQDEIFHNGEKGFYRTSNRAGGIEGGVSNGQPVVVRVAMKPIPTLRRPLASVDLVSLTPSEAAFERSDICAVPAACVIGEAVLAFELARACLEKFGGDSMTELLDNHRRYLERIRANRAGG

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.779 kDa

MSHNSFGHLFRVTTFGESHGPALGCVVDGCPPLIPLDAAEIQAELDRRRPGQSRFTTQRREPDAVRILSGVFADDRTGGRQLTTGTPIALMIENVDQRSKDYSDIRDTYRPGHADYTYEAKYGIRDYRGGGRSSARETAARVAAGAIARKVLPGVTIRGALVQMGPHAIDRARFDWAEVGNNPFFCPDAEAAARWAEVLDGVRKDGSSLGAVIEVVAEGVPPGLGAPVYGKLDADLAAAMMSINAVKGVEIGDGFAAAALRGEENADEMRPGHGGAPSFLANHAGGILGGISTGQAVVCRFAVKPTSSILTPRASVTRDNRPTDVLTRGRHDPCVGIRAVPVGEAMMACVLADHVLRHRGQVGAHPAGAHPAGADPAGTHPGGPGGFQPG

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.387 kDa

MPGNSFGKIFRITTFGESHGPAVGVVVDGVPAGLRLSQEDLEFELSFRRPGRLYVSGRREKDVPEILSGVYNGRTTGSPIAIVVKNTDVISSFYEEVKVKPRPGHADLPFIMRYGYENWDYRGGGRSSARETVGRVAAGAIAKKLLMFHDTWIAGRLKSLGPVDSPPADFLQILCSKYSPVRASDPETEAKFQELVKQATVEGDSYGGVAEIVVKNPPAGLGEPVFDKIKADLAKAILSIPAVTGFEYGLGFQASRMKGSEANDSIVRKGERLGWRENKSGGILGGITTGEDIVVRCSFKPTSSIRKPQGTVDLRTGEPAEISVLGRHDPAVAIRGVSVAESMVALTLVDHSLRSGVIPPVKLEERQAEVIEDRWRRYMEECRPTAESQS

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.44 kDa

MLRFLNAGESHGPALTAIIEGYPSNVKITTDRINKELARRQKGYGRGGRMKIEKDTVEILSGVRFGITLGSPITLVVRNKDWENWTDIMAIEGDSTNKRQILEPRPGHADLTGGIKYGFYDLRNILERASARETTTRVAVGALCKILLEDIGIKIGSYVLSIGEKKIDKSEIESISYEDRFNNAENSELRLPILGKDEEFKEYIDKAKEDGESLGGIFEVYALNVPVGLGSYSQWDTRLDGKIAQAIMSIQAIKGVEIGEGFNLAYLPGSQAHDEIFYSKERGFYRKTNRAGGLEGGMTNGEPIIVRAAMKPIPTLMRHKSLQSVNVITKEPFDAAKERSDITAVPAAAVVAESMLAFVLAREILEKFGSDNWIQIKERIEKYRQDVLNY

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.019 kDa

MPGNSFGELFRITTFGESHGPMVGVVIDGVPAGLPIKKEDIEFELSFRRPGRQFVTGRREKDEPEIVSGVYNGRTTGAPITILVKNTDVISSLYEEIHYKPRPGHADLPYIMKYGFENWDYRGGGRASARETVGRVAASAIAKKLLMLTDTWIAGHLKSLGYVELNEPVTFEEVLCSKYSPVRASKKWLEKKYEELVKQATVEGDSWGGIAEIIVRNPPIGLGEPVFDKLKADLAKALLSIPAVMGFEYGLGFNAAKMKGSEANDEIVKKGDKYRWKFNNSGGILGGLSTGEDILVRCAFKPTSSIRKPQKTIDLRTGEETTISVIGRHDPAVAIRGVSVAEAMVSLVIVDHAMRAGYIPTVRISDDQIKIIEERWNKYISLCKPTQVSQ

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.382 kDa

MRYITAGESHGPQLTTILEGIPAGLPLVADDINAELARRQKGYGRGRRMQIEKDQVQIVSGVRHGQTIGAPIALIVENKDFAHWTKIMGAAPLTEQEKKEMKRQITRPRPGHADLNGAIKYGHRDMRNVLERSSARETTVRVAAGAVAKKVLAELGIKVAGHVIEIGGVRAEQTTYETIEQLQEITEASPVRCLDGEAGKKMMQAIDDAKASGDSIGGIVEVIVEGMPIGVGSYVHYDRKLDAKLAAAVMSINAFKGVEIGIGFEAAHRPGSQVHDEILWNEEEGYTRRTNHAGGLEGGMTTGMPVVVRGVMKPIPTLYKPLQSVDIETKESFSASIERSDSCAVPAASVVAEAVVAWELATALVEQFGADRMDCIRENIERHNEYAREF

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.401 kDa

MRYLTAGESHGPQLTTIIEGAPAQLELVADDINVDLARRQGGHGRGRRMQIEKDQVQIVGGIRHGKTTGAPIALVVENKDWKHWTKIMGAEPLTGDEEKEIKRKITRPRPGHADLNGAIKYGHRDMRNVLERSSARETTVRVAAGAVAKKILRTFGIEVGSHVLEIGGVKAEKTSYDQLSNLKELAEASPVRCLDKEAEQEMIAAIDQAKENGDSIGGVVEVIVEGVPIGLGSHVHYDRKLDAKIAAAVMSINAFKGVEFGIGFEAASKPGSEVHDEIAWDEERGYYRKSNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIATKEPFAASIERSDSCAVPAAAVVAEAVVAWEVANALLERFGADQVEEIEKNIREFNEKARLF

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.835 kDa

MRYLTAGESHGPQLTTIIEGVPAGLYITKEDIDYELQRRQKGHGRGRRMQIEKDQARITSGVRHGRSLGSPIALVVENNDWKHWTKIMGSEPITAEEESEMKRQISRPRPGHADLNGAIKYGHRDMRNVLERSSARETTVRVAAGAVAKKILSQLGIQVAGHVLEIGGVKAEKTNYESIENLKKVTEESPVRCYDEEAGRKMMDAIDEAKANGDSIGGIVEVIVEGVPVGVGSYVHYDRKLDSKLAAAVLSINAFKGVEFGIGFEAARKNGSEVHDEIIWDEEKGYTRATNRLGGLEGGMTTGMPIVVRGVMKPIPTLYKPLKSVDIETKEPFTASIERSDSCAVPAASVVAEAVVAWEIANAIVEQFGVDQMDRIAENVEKMRKLAREF

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.738 kDa

MRYLTAGESHGPQLTTIIEGVPAGLYIEQDDINYELARRQKGHGRGRRMQIEKDQAKVLSGVRHGKTLGSPIALVVENNDWKHWTKVMGAEPITEEEESEMKRQISRPRPGHADLNGAIKYGHRDMRNVLERSSARETTVRVAAGAVAKQILAHLGIKVAGHVLEIGGVKAAHTAYESIEDLQKVTEESPVRCYDSEAGQKMMDAIDEAKKNGDSIGGIVEVIVEGMPVGVGSYVHYDRKLDSKLAGAVLSINAFKGVEFGIGFEAASKNGSEVHDEIIWDEEKGYTRKTNRLGGLEGGMSTGMPIVVRGVMKPIPTLYKPLQSVDIETKEPFSASIERSDSCAVPAASVVAEAVVAWEIANAVVEQFGLDQIDRIKENVEKMRQLQREF

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.378 kDa

MRFLTAGESHGPQLTAIIEGVPAQLPLLAEDIDRELARRQGGYGRGRRMQIEKDRVQIVSGVRHGMTTGAPITFVVENKDWKNWTKIMGAEPISEEEAEKMRRKLTRPRPGHADLNGAIKYGHRDMRNVLERSSARETTVRVACGALAKVILKACGIEVAGHVREIGGIRAEETNYATIQELQKRSEESPVRCLDEDASKKMMAAIDKAKQDGDSIGGIVEVVVAGVPIGLGSHVHYDRKLDGKIAGAVMSINAFKGVEIGIGFEAARLPGSQVHDEITWSEEEGYKRKTNRLGGFEGGMTNGMPIVVKGVMKPIPTLYKPLQSVDIDSKEPFAAGVERSDSCAVPAASVVCENVVAWEVANALLDTFGSDQLPLIQAAVERHHAASKEF

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.806 kDa

MRYLTAGESHGPQLTTIIEGVPAGLYITEEDINFELARRQKGHGRGRRMQIEKDQAKIMSGVRHARTLGSPIALVVENNDWKHWTKIMGAAPITEDEEKEMKRQISRPRPGHADLNGAIKYNHRDMRNVLERSSARETTVRVAAGAVAKKILSELGIKVAGHVLQIGAVKAEKTEYTSIEDLQRVTEESPVRCYDEEAGKKMMAAIDEAKANGDSIGGIVEVIVEGMPVGVGSYVHYDRKLDSKLAAAVLSINAFKGVEFGIGFEAAGRNGSEVHDEIIWDEEKGYTRATNRLGGLEGGMTTGMPIVVRGVMKPIPTLYKPLKSVDIETKEPFSASIERSDSCAVPAASVVAEAAVAWEIANAVVEQFGLDQIDRIRENVENMRKLSREF

aroC

Chorismate synthase

390 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.667 kDa

MRYLTAGESHGPQLTTIIEGVPAGLYITEEDINFELARRQKGHGRGRRMQIETDRAKITSGVRHARTLGSPIALVVENKDWTHWTKIMGAAPITEEEESEMKRQISRPRPGHADLNGAIKYNHRDMRNVLERSSARETTVRVAAGAVAKKILAELGIKVAGHVLQIGSVKAEKTDYTSIEDLKRVTEESPVRCYDEEAGRQMMAAIDEAKANGDSIGGIVEVIVEGMPVGVGSYVHYDRKLDSKLAAAVLSINAFKGVEFGIGFEAAGKNGSEVHDEIVWDEEKGYTRATNRLGGLEGGMTTGMPIVVRGVMKPIPTLYKPLKSVDIETKEPFTASIERSDSCAVPAASVVAEAAVAWEIANAVVEQFGLDQIDRIKENVENMKKLSREF

aroC

Chorismate synthase

389 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.488 kDa

MINYVTAGESHGPQLTGVLTGIPAGLQLDIDAINTGLAARQGGFGRGNRQQIEHDTVQIIGGVRHGVTLGSPIALTIMNRDHAHWAAIMDPVSPATATNTLRQVTRPRPGHADLVGGMKYGHRDLRNVLERSSARETAMRVAIGQICKQLLAQLDIHLVGYVQQIGPKQVTADLTLSVDQLQAQIAQNDLRLPDAALVPEIHELITATKKAGDTLGGVIRVVAENVPAGLGSYTNWDTKLDGQLAAAVMGVNAMKGVEIGDGFAAASHYGSQVMDEISWDEHAGWSRLTNHLGGFEGGMTNGMPIVVKAAMKPIPTLYKPLQSVDIATKVSQKASVERSDTTAIVPASIVVESVVAIELTRALTATFDGSNLARLQQTVTAYREELRQY

aroC

Chorismate synthase

389 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.724 kDa

MRFGFSTAGESHGPAEVVIVHGVPAGLRLLAEDVDRDLARRQLGYGRGGRQKIERDRVEFLGGVRHGRTLGSPVAMLVRNRDYANWERRMNPAPVEDPPEPITLPRPGHADLAGMQKYGFGDLRNVLERSSARETVARVAAGAVARRLLGEFGVRVFSAVYRIGEVAMDRALAAAGAGKADRSEVRCPDPEVSERMKAEIDAARHARDALGGEFVVVAEGCPPGLGSYADWRDRLDARLAAAVVSINAIKGVEIGDAFEAARRRSSEVQDEIVRRGGALGRASNRLGGLEGGMTNGEPVVVAAAMKPISTIARALRTVDLSTGEEARAFRERADSCAVPAAAVIGEAMVAVVLAEAFLEKFGADALEDIRASYEHYMRRIGLPARRADA

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.636 kDa

MLTYLTAGESHGPQGTAIIEGIPAGLAIDVDQINADLASRQGGYGRGSRQQIEHDQVEILGGVRHGLTLGSPITLVVKNRDHAHWSSIMHPTSPATAENTLRKVERPRPGHADLVGGMKYRHRDLRNVLERSSARETAIRVAVGNVCKQLLAALGVTLVGYVQAIGPVDTDLTKPQTVSEIKDAITQNNLRILAQDRVAELHDLIDQTRRAGDTLGGWIRVVVNGMPAGIGSYVSWDTKLDGQLAAAVMGVNAMKGVSIGDGFEISRHPGSQGMDEISHDADGYHRLSNHLGGLEGGMTNGMPLIINAAMKPIPTLYKALKTVNVVTKEVEKASVERSDTTAIVPASIVIENVVAIELAKALTNSFNADNLARLQEQLAAYREELRGY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.634 kDa

MRYFTAGESHGPRLTAIIEGVPAGLSLSAEDINIELKRRQGGYGRGGRMKIESDQVEITSGVRHGKTIGSPITLNVTNRDFKNWEQIMAAQDVEDKIKKQRRLTKPRPGHADLVGGMKYEFEDLRNVLERSSARETTMRVAVGAVAKKLLHELEIEIANHVVNFGGREITSPENLSVQDIRQTAGLSDLSIFDESQAEELRNYIDQIKKAGDTIGGIIETRVEGVPAGLGSYVQYDRKLDAKIAAAVVSINAFKGVEFGLGFEAGKRPGSQVMDEIIWSEDKGYTRSSNQLGGFEGGMTNGEQVIVRGVMKPIPTLYKPLMSIDIESHEPYKASVERSDPTALPAAGVVMENVVATVVAQEICDKFDSDTMNELRDAVASYKKRLSEY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.683 kDa

MRYFTAGESHGPRLTAIIEGVPAGLSLSAEDINIELKRRQGGYGRGGRMKIESDQVEITSGVRHGKTIGSPITLNVTNRDFKNWEQIMAAQDVEDKIKKQRRLTKPRPGHADLVGGMKYEFEDLRNVLERSSARETTMRVAVGAVAKKLLHELEIEVANHVVNFGGREISSPEHLSVQEIRETAGRSDLSIFDESQAEDLRTYIDQIKKAGDTIGGIIETRVEGVPAGLGSYVQYDRKLDAKIAGAVVSINAFKGVEFGLGFEAGKRPGSQVMDEIIWSENKGYTRSSNQLGGFEGGMTNGEQLIVRGVMKPIPTLYKPLMSIDTESHEPYKASVERSDPTALPAAGVVMENVVATVVAQEICDKFNSDTINELKKALVDYKKRLSEY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.783 kDa

MRYFTAGESHGPRLTAIIEGVPAGLSLSAEDINIELKRRQGGYGRGGRMKIESDQVEITSGVRHGKTIGSPITLNVTNRDFKNWEQIMAAQDVEDKIKKQRRLTKPRPGHADLVGGMKYEFEDLRNVLERSSARETTMRVAVGAVAKKLLHELEIEVANHVVNFGRREISSPEHLSVQEIRETAGRSDLSIFDESQAEDLRTYIDQIKKAGDTIGGIIETRVEGVPAGLGSYVQYDRKLDAKIAGAVVSINAFKGVEFGLGFEAGKRPGSQVMDEIIWSENKGYTRSSNQLGGFEGGMTNGEQLIVRGVMKPIPTLYKPLMSIDTESHEPYKASVERSDPTALPAAGVVMENVVATVVAQEICDKFNSDTINELKKALVDYKKRLSEY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.46 kDa

MRFITAGESHGPELTAIIEGLPAGLPLSSEEINRELARRQGGYGRGGRMKIEKDQVRITSGIRHGKTLGSPVTLIVENKDWKNWTSVMSVEPVPEKQKKIRRVSKPRPGHADLVGGMKYQHDDLRNVLERSSARETTMRVAIGAVAKKLLAELDIQVAGHVAVLGGIEATIPENLTIREIQERSEQSAVRVLDPSVEEKMKELIDQTKKNGDTIGGVVEVLVGGVPAGLGSYVQWDRKLDAKIAQAVVSINAFKGAEFGIGFEMAQRPGSQVMDEIVWDESTGYTRTSNNLGGFEGGMTNGMPIIVRGVMKPIPTLYKPLQSVNIDTKEPYKASVERSDSTAVPAASVVCEAVVATEVAKAMLEKFDSDSFEQMKEAVKRYRLYTQNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.582 kDa

MRYLTAGESHGLSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.845 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.582 kDa

MRYLTAGESHGLSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.566 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.566 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.54 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDQVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGVDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQLLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.566 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.612 kDa

MRYLTAGESHGLSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGTRMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.845 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.757 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINGDLKRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVVNKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKYRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.658 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITILYKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.872 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIENDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.565 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEKEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.845 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.566 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPIVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.872 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIENDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.497 kDa

MRYLTAGESHGPRLTAIIEGVPAGLPLTAEDINEELKRRQGGYGRGSRMQIETDRVEITAGVRHGKTTGAPITLNVTNKDHQKWLDIMAVEDIEEKLKSKRRIKHPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRILAELDIEIANHVVVFGGKEIDVPDGLSVAEIKERAAQSEVSIVNQEREEEIKAYIDQIKRDGDTIGGVIETVVGGVPAGLGSYVQWDKKLDAKLAQAVVSINAFKGVEFGVGFQAGYLKGSQVMDEILWSQEKGYTRRTNNLGGFEGGMTNGEALIIRGVMKPIPTLYKPLMSVDIDTHEPYKATVERSDPTALPAAGVVMESVVATTLATEILEKFSSDNMEELKAAVASHRDYVKNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.469 kDa

MRYLTAGESHGQALTAIIEGIPAGLTLSAELINKELKRRQGGYGRGARMRIESDRVHISSGVRHGKTTGAPITLTIQNKDHQKWLDIMAVEAVEEQIKLKRKITHPRPGHADLVGGIKYRFDDLRNALERSSARETAMRVAVGAVAKVVLTELGIETANHVLVFGGIEVAVPEAMPFTDIKKAAEASDLSIVNPKQEATIKAHIDQVKKEGDTLGGIIETIIHGLPAGLGSYVQWDRKLDAKIAQAVLSINAFKGVEFGMGFDMGYQKGSQVMDEIIWHETSGYSRRTNRLGGFEAGMTTGQPIVVKGVMKPIPTLYKPLMSVDTETHEPYKATVERSDPTALPAAGVVMENVVATVITKEILEQFPSDNMTDLKQAFFAYCDYVHHF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.236 kDa

MRYLTAGESHGPRLTAIIEGVPAGLPLTADYINAELKRRQGGYGRGARMKIESDQVEITSGVRHGLTMGGPITLNVTNLDHQKWQEIMSAADVDEKKKGLRKITKPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLEEIGVEVASHIVTFGGIDINVPNNLTVGEIKERAAQSEVSIVNPDREEEIKAYIDQIKKDGDTIGGVIETVVGGVPVGLGSYVQWDKKLDAKIAQGVVSINAFKGVEFGVGFEAGRLKGSQVMDEILWSEEDGFTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGVVMESVVATVLATEVLEKFSSDNLEELKDAVARHREFVKNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.497 kDa

MRYLTAGESHGPRLTAIIEGVPAGLPLTAEDINEELKRRQGGYGRGSRMQIETDRVEITAGVRHGKTTGAPITLNVTNKDHQKWLDIMAVEDIEEKLKSKRRIKHPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRILAELDIEIANHVVVFGGKEIDVPDGLSVAEIKERAAQSEVSIVNQEREEEIKAYIDQIKRDGDTIGGVIETVVGGVPAGLGSYVQWDKKLDAKLAQAVVSINAFKGVEFGVGFQAGYLKGSQVMDEILWSQEKGYTRRTNNLGGFEGGMTNGEALIIRGVMKPIPTLYKPLMSVDIDTHEPYKATVERSDPTALPAAGVVMESVVATTLATEILEKFSSDNMEELKAAVASHRDYVKNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.663 kDa

MRYLTAGESHGPRLTAIIEGVPAGLPLTAEDINGDLKRRQGGYGRGGRMKIESDKVEITSGVRHGKTTGAPITLHVINKDHQKWLDIMAVEDIEDRLKTKRKITHPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRILAELDIEIANHVVVFGGKEIDVPENLTVAQIKELAQQSEISVVNQEREQEIKDYIDQIKKEGDTIGGVVETVVGGVPVGLGSYVQWDTKLDAKIAQAVVSINAFKGVEFGLGFKDGYLRGSQVMDEILWNEEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGVVMESVVATVVANEILDKFSSDNLEELKEAVAHHRDYVKNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.663 kDa

MRYLTAGESHGPRLTAIIEGVPAGLPLTAEDINGDLKRRQGGYGRGGRMKIESDKVEITSGVRHGKTTGAPITLHVINKDHQKWLDIMAVEDIEDRLKTKRKITHPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRILAELDIEIANHVVVFGGKEIDVPENLTVAQIKELAQQSEISVVNQEREQEIKDYIDQIKKEGDTIGGVVETVVGGVPVGLGSYVQWDTKLDAKIAQAVVSINAFKGVEFGLGFKDGYLRGSQVMDEILWNEEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGVVMESVVATVVANEILDKFSSDNLEELKEAVAHHRDYVKNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.663 kDa

MRYLTAGESHGPRLTAIIEGVPAGLPLTAEDINGDLKRRQGGYGRGGRMKIESDKVEITSGVRHGKTTGAPITLHVINKDHQKWLDIMAVEDIEDRLKTKRKITHPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRILAELDIEIANHVVVFGGKEIDVPENLTVAQIKELAQQSEISVVNQEREQEIKDYIDQIKKEGDTIGGVVETVVGGVPVGLGSYVQWDTKLDAKIAQAVVSINAFKGVEFGLGFKDGYLRGSQVMDEILWNEEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGVVMESVVATVVANEILDKFSSDNLEELKEAVAHHRDYVKNF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.539 kDa

MRYLTAGESHGPSLTTIIEGIPSGLELSSEVINLELKRRQGGYGRGARMTIENDKVSITSGVRHGKTTGAPITLIIENKDHKKWTDIMAVEDLPDKLKRKRKVIHPRPGHADLVGGIKYGYSDLRNALERSSARETAARVAVGAVAKCLLSQLGIETMHHVSVFGGVTIDIPETLTYEELRTKAQKSELSIVNSEQEVEIKTYIDQIKKDGDTLGGVVQTIVTGVPVGLGSYVQWDKKLDAKLAQAVMSINAFKGVEFGEGFAMGYQKGSEVMDEIIWSEEEGYSRKSNHLGGFEGGVTNGQPLLIKGVMKPIPTLYKPLQSVNIETHQPYKASVERSDPTALPAAGVVMENVVATVLAQEILEKFSSDTMKELTKAFQDYTNYTKRY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.845 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.845 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.872 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIENDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.287 kDa

MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLKRDYAVSEIQETSEASPVRCLDEVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.257 kDa

MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVREIQETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.188 kDa

MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVSEIQETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.257 kDa

MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVREIQETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.172 kDa

MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVAEIQETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.331 kDa

MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITAGIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYGHNDMRNVLERSSARETTVRVAAGAIAKKLLHELGIEVAGHVLEIGGTRANLTRDFSVSEIKETSEASPVRCLDEVAEKEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLDAKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTNGMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAVAVLEKFDGDRFDTLKKHVEEHRNLTKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.088 kDa

MRYLTSGESHGPQLTVIVEGIPANLEIKVEDINKEMFKRQGGYGRGRRMQIEKDTVEIVSGVRNGYTLGSPITMVVTNDDFTHWRKIMGAAPISEEERENMKRTITKPRPGHADLVGGMKYNHRDLRNVLERSSARETAARVAVGALCKVLLQQLDIDIYSRVVEIGGIKDKDFYDSKTFKANLDRNDVRVIDDSIAQAMRDKIDEAKNDGDSIGGVVQVVVENMPVGVGSYVHYDRKLDGRIAQGVVSINAFKGVSFGEGFKAAEKPGSEIQDEILYNTELGYYRGSNHLGGLEGGMSNGMPIIVNGVMKPIPTLYKPLNSVDINTKEDFKATIERSDSCAVPAASIVCEHVVAFEIAKALLEEFQSNHIEQLKQQIIERRQLNIEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.761 kDa

MRFLTSGESHGPQLTVIIEGVPANLKITAEDINEEMFKRQGGYGRGRRMKIEKDGVEIVSGVRNGYTLGSPVTIVVTNDDFTHWRNIMGVAPISEEEQEQMKRTISKPRPGHADLIGGIKYNHRDLRNVLERSSARETAARVAVGAVCKILLKQLGINVLSRVVEIGGIKDDTDYDLDTIKKHEDSNDVRVVNEDIAQEIRAKIDQAKKDGDSLGGVVQVIVKNMPVGIGSYVHYDRKLDGRIAQGVVGINAFKGVSFGEGFKAAEKPGSQIQDPILYNDEEGYTRASNHLGGLEGGMSNGMPIVVNGVMKPIPTLYKPLASVDIETKEPFKATIERSDSCAVPAASIVCEHAVAFEITKTLLEEFQSNYMEQLQQQVDERRLRNIEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.105 kDa

MRYLTSGESHGPQLTVIIEGVPANLEIKAEDINKEMFKRQGGYGRGRRMKIEKDTIEIVSGVRNGFTLGSPITLVVTNDDFTHWRKIMGVAPISDEERENMKRTITKPRPGHADLIGGMKYNHRDLRNVLERSSARETAARVAVGAVSKILLEQLDIHLYSRVVEIGGIKDKGLYDVDMFKNNVDKNDVRVIDENIAQQMRDKIDEAKKDGDSIGGVVQVMAENMPIGVGSYVHYDRKLDGRIAQGVVSINAFKGVSFGEGFKAAEKPGSEIQDEIHYNQDSGYFRATNHLGGFEGGMSNGMPIIVNGVMKPIPTLYKPLNSVDINTKEDFKATIERSDSCAVPAASVVCEHVVAFELAKAVLEEFQSNHMDQLVAQIKERRQLNIEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.105 kDa

MRYLTSGESHGPQLTVIIEGVPANLEIKAEDINKEMFKRQGGYGRGRRMKIEKDTIEIVSGVRNGFTLGSPITLVVTNDDFTHWRKIMGVAPISDEERENMKRTITKPRPGHADLIGGMKYNHRDLRNVLERSSARETAARVAVGAVSKILLEQLDIHLYSRVVEIGGIKDKGLYDVDMFKNNVDKNDVRVIDENIAQQMRDKIDEAKKDGDSIGGVVQVMAENMPIGVGSYVHYDRKLDGRIAQGVVSINAFKGVSFGEGFKAAEKPGSEIQDEIHYNQDSGYFRATNHLGGFEGGMSNGMPIIVNGVMKPIPTLYKPLNSVDINTKEDFKATIERSDSCAVPAASVVCEHVVAFELAKAVLEEFQSNHMDQLVAQIKERRQLNIEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

43.077 kDa

MKYLTSGESHGPQLTVIIEGVPANLEIKAEDINKEMFKRQGGYGRGRRMQIEKDAVEIVSGVRNGYTLGSPITIVVTNDDFTHWRNIMGIEPISDEERDNMKRTITKPRPGHADLIGGMKYNHRDLRNVLERSSARETAARVAVGAVSKILLEQLDIHMYSRVVEIGGIKDEGLYDTETFKQNIDKNDVRVIDETIAQKMRDKIDAAKKDGDSIGGVVQVMVENMPVAVGSYVQYDRKLDGRIAQGVVSINAFKGVSFGEGFKAAEKPGSEIQDEILYDNEIGFYRGSNHLGGFEGGMTNGMPIIVNGVMKPIPTLYKPLNSVDINTKEDFKATIERSDSCAVPAASVVCEHVVAFEVAKAITEEFQSNHIDQLKAQIDERRRLNIEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.746 kDa

MRYLTSGESHGPQLTVIIEGVPANLEINVADINEEMFKRQGGYGRGRRMQIEKDAIEIVSGVRNGYTLGSPITLIVTNDDFTHWKKIMGADPISEEDQDNMKRVITKPRPGHADLIGGMKYNHRDLRNVLERSSARETAARVAVGAVSKILLKQLDINFYSRVVEIGGVKDDLEYDLDTIKSNIDKNDVRVVNDEIAQTMRDKIDAAKKAGDTIGGVVQTIIEGVPVGIGSYVHYDRKLDGRIAQGVVSINAFKGVSFGEGFKAAEKPGSEIQDEILYDTTNGYYRGSNHLGGFEGGMSNGMPIVVNGVMKPIPTLYKPLNSVDINTKESFKASIERSDSCAVPAASVVVENVVAFELAKALLEEFQCNHIEQLQSQIKERRLLNIEY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.625 kDa

MRYLTAGESHGPSLTAIIEGIPAGLKLSAKDINEDLKRRQGGYGRGNRMKIETDQVIISSGVRHGKTLGSPITLTVTNKDHSKWLDIMSVEDIEERLKQKRRIKHPRPGHADLVGGIKYRFDDLRNALERSSARETTMRVAIGAIAKRILKEIGIEIANHIVVFGGKEITVPDKLTVQQIKVLSSQSQVAIVNPSFEQEIKDYIDSVKKAGDTIGGVIETIVGGVPVGLGSYVHWDRKLDAKIAQAVVSINAFKGVEFGLGFKSGFLKGSQVMDSISWTKDQGYIRQSNNLGGFEGGMTNGEPIVVRGVMKPIPTLYKPLMSVDIDTHEPYRATVERSDPTALPAAGVVMEAVVATVLVTEVLEKFSSDNMYELKEAVKLYRNYVNHF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.639 kDa

MRYLTAGESHGPSLTAIIEGIPAGLKLSAKDINEDLKRRQGGYGRGNRMKIETDQVIISSGVRHGKTLGSPITLTVTNKDHSKWLDIMSVEDIEERLKQKRRIKHPRPGHADLVGGIKYRFDDLRNALERSSARETTMRVAIGAIAKRILKEIGIEIANHIVVFGGKEITVPDKLTVQQIKVLSSQSQVAIVNPSFEQEIKDYIDSVKKAGDTIGGVIETIVGGVPVGLGSYVHWDRKLDAKIAQAVVSINAFKGVEFGLGFKSGFLKGSQVMDSISWTKDQGYIRQSNNLGGFEGGMTNGEPIIVRGVMKPIPTLYKPLMSVDIDTHEPYRATVERSDPTALPAAGVVMEAVVATVLVTEVLEKFSSDNMYELKEAVKLYRNYVNHF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.626 kDa

MRYLTAGESHGPSLTAIIEGIPAGLKLSAKDINEDLKRRQGGYGRGNRMKIETDQVIISSGVRHGKTLGSPITLTVTNKDHSKWLDIMSVEDIEERLKQKRRIKHPRPGHADLVGGIKYRFDDLRNALERSSARETTMRVAIGAIAKRILKEIGIEIANHIVVFGGKEITVPDKLTVQQIKVLSSQSQVAIVNPSFEQEIKDYIDSVKKAGDTIGGVVETIVGGVPVGLGSYVHWDRKLDAKIAQAVVSINAFKGVEFGLGFKSGFLKGSQVMDSISWTKDQGYIRQSNNLGGFEGGMTNGEPIIVRGVMKPIPTLYKPLMSVDIDTHEPYRATVERSDPTALPAAGVVMEAVVATVLVTEVLEKFSSDNMYELKEAVKLYRNYVDHF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.535 kDa

MRYLTAGESHGQALTAIIEGIPAGLALSAELINKELKRRQGGYGRGARMRIESDRVHISSGVRHGKTTGAPITLTIQNKDHQKWLDIMAVEAVEEQIKFKRKITRPRPGHADLVGGIKYRFDDLRNALERSSARETAMRVAVGAIAKAILTELGIETANHVLVFGGIEVAVPEAMSFADIKKVAESSDLSIVNPKQEATIKAHIDQVKKEGDTLGGIIETLIHGLPAGLGSYVQWDRKLDAKIAQAVLSINAFKGVEFGMGFDMGYQKGSQVMDDIIWHETSGYSRRTNRLGGFEAGMTTGQPIVVKGVMKPIPTLYKPLMSVDTETHEPYKATVERSDPTALPAAGVVMENVVATVITKEILEQFPSDNMTDLKQAFFAYRDYVHHF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.573 kDa

MRYLTAGESHGQALTAIIEGIPAGLALSAELINKELKRRQGGYGRGARMRIESDRVHISSGVRHGKTTGAPITLTIQNKDHQKWLDIMAVEAVEEQIKFKRKITRPRPGHADLVGGIKYRFDDLRNALERSSARETAMRVAVGAIAKAVLTELGIETANHVLVFGGIEVAVPEAMPFTDIKKAAEASDLSIVNPKQEATIKAHIDQVKKEGDTLGGIIETIIYGLPAGLGSYVQWDRKLDAKIAQTVLSINAFKGVEFGMGFDMGYQKGSQVMDDIIWHETSGYSRRTNRLGGFEAGMTTGQPIVVKGVMKPIPTLYKPLMSVDTETHEPYKATVERSDPTALPAAGVVMENVVATVITKEILEQFPSDNMTDLKQAFFAYRDYVHHF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.641 kDa

MRYFTAGESHGPRLTAIIEGVPAGLPLTADYINAELRRRQGGYGRGGRMKIESDQVEITSGVRHGLTMGSPITLNVTNRDFKNWTEIMSAADIEDKKKSIRKLTKPRPGHADLVGGMKYRFSDLRNSLERSSARETTMRVAVGSVAKRLLEELEITIASHVVVLGGIEVDVPENLTVAEIKERASQSEISVVNQEHEQEIKDYIDQIKKEGNTIGGIIETVVGGVPVGLGSYVQWDRKLDAQIAQGVVSINAFKGVEFGLGFKDGYLKGSYVMDEITWSKEDGYRRKSNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKASVERSDPTAVPAAAVVMEGVVATVLATEILNKFSSDNMEELKEAVKSHQKFIKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.538 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEEEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGAGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.872 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIENDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGLGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.565 kDa

MRYLTAGESHGPSLTAIIEGIPAGLTLHPADIDHELQRRQGGYGRGARMSIETDRVQISSGVRHGKTTGAPITLTVINKDHQKWLDVMAVGDIEETLKLKRRVKHPRPGHADLVGGIKYHFNDLRDALERSSARETTMRVAVGAVAKRILAELGIDMLHHILIFGGITITIPSKLSFRELQERALHSELSIVNPKQEKEIKTYIDKIKKEGDTIGGIIETIVQGVPAGLGSYVQWDKKLDAKLAQAVLSINAFKGVEFGVGFDMGFQKGSQVMDEITWTPTQGYGRQTNHLGGFEGGMTTGQPLVVKGVMKPIPTLYKPLMSVDIDSHEPYKATVERSDPTALPAAGVIMENVVATVLAKEILETFSSTTMSELQKAFSDYRAYVKQF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.843 kDa

MRYLTAGESHGPRLTAIIEGIPAGLPLTAEDINEDLRRRQGGYGRGGRMKIESDQVVFTSGVRHGKTTGAPITMDVINKDHQKWLDIMSAEDIEDRLKSKRKITHPRPGHADLVGGIKYRFDDLRNSLERSSARETTMRVAVGAVAKRLLAELDMEIANHVVVFGGKEIDVPENLTVAEIKQRAAQSEVSIVNQEREQEIKDYIDQIKRDGDTIGGVVETVVGGVPVGXGSYVQWDRKLDARLAQAVVSINAFKGVEFGLGFEAGYRKGSQVMDEILWSKEDGYTRRTNNLGGFEGGMTNGQPIVVRGVMKPIPTLYKPLMSVDIETHEPYKATVERSDPTALPAAGMVMEAVVATVLAQEILEKFSSDNLEELKEAVAKHRDYTKNY

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.548 kDa

MRYLTAGESHGPQLTAILEGVPAGLELRAEHINKELARRQKGYGRGRRMQIEKDEVKITGGVRHGKTLGSPIALVVENRDFKHWQTIMAVEPIDDEAEVKRKVTRPRPGHADLNGALKYGHRDMRNVLERSSARETTVRVAAGAVAKRILEEVGIRVAGHVIEIGGVRAKKLDYRSLEELQAVTEESPVRCFDPEAGQKMMEAIDWAKKNGDSIGGIVEVIVEGVPAGVGSYVHYDRKLDAKIAAAIVSINAFKGVEFGIGFEAARRPGSEVHDEIIWSPEQGFSRRTNRAGGFEGGVTTGMPIVVRGVMKPIPTLYKPLQSVDIETKEPFAASIERSDSCAVPAASVVAEAVVAWEVAAAIVEQFGQDRMDLIKENVERARRYAKEF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.887 kDa

MRYLTAGESHGPQLTTILEGVPAGLTLLAEHINKELARRQKGYGRGRRMQIEKDEVKIFSGVRHGKTLGSPITLVVENRDWKHWQNIMSIEPIDSAEEVKRKVTRPRPGHADLNGALKYGHRDMRNVLERSSARETTVRVAAGAVAKRILEELGIRVAGHVIEIGGVRAERMDYRSLEELQQVTEESPVRCFDEKAAVKMMEAIDEAKKNGDSIGGIVEVIVEGVPAGVGSHVHYDRKLDAKIAAAIVSINAFKGVEFGIGFEAARRPGSEVHDEIIWSKEKGFTRRTNRAGGFEGGMTTGMPIVVRGVMKPIPTLYKPLQSVDIETKEPFTASIERSDSCAVPAASVVAEAVVAWEVASAIVDQFGQDRMDLIKENVEKMRRYAREF

aroC

Chorismate synthase

388 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.548 kDa

MRYLTAGESHGPQLTAILEGVPAGLELRAEHINKELARRQKGYGRGRRMQIEKDEVKIVGGVRHGKTLGSPIALVVENRDFQHWQTIMAVEPIDDETEVKRKVTRPRPGHADLNGALKYGHRDMRNVLERSSARETTVRVAAGAVAKRLLEEVGIRVAGHVLEIGGVRAEKLDYRSLDELQKVTEESPVRCFDPEAGQKMMEAIDLAKKNGDSIGGIVEVIVEGVPAGVGSYVHYDRKLDAKIAAAIVSINAFKGVEFGIGFEAARRPGSEVHDEIIWSPEQGFSRRTNRAGGFEGGMTTGMPIVVRGVMKPIPTLYKPLGSVDIDTKEPFTASIERSDSCAVPAASVVAEAVVAWEVAAAIVEQFGQDRIDLIKENIERARRYAREF

aroC

Chorismate synthase

387 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.547 kDa

MRYLTAGESHGPQLTAIIEGVPSNLPISIEEINEQLARRQKGHGRGRRMQIEKDQVKILSGVRHGYTTGAPITLVVENKDWTHWQGIMSAEPVEEGSEEKRRVSRPRPGHADLNGAIKYHQRDMRNILERSSARETTVRVAVGAVARQLLAQFGIRIGGQVLQINEIVAKRQEVSLDELIARTEESPVRCLDKEAEPLMMAAIDKAKEDGDSLGGTVEVIVEGVPIGLGSHVQWDRKLDGRLAQAIMSIQAFKGVEIGIGFEAAGLKGSQVHDEIVWNEETGYSRKTNRAGGLEGGMTTGMPVVVRGVMKPIPTLYKPLMSVDIDSREPFSASIERSDSCAVPAASVVAEAVVAWEIANAMCEKFPSDSLDDMEENVRQYRAYTEKF

aroC

Chorismate synthase

387 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.595 kDa

MRYLTAGESHGPGLTVIIEGAPAGLAIDISQINAELKKRQSGYGRGRRMQIESDQVEVRSGIRHGVTTGAPITFWIENKDHTHWKHVMQAEPIESDIEVKRRVSRPRPGHADLVGGMKYDHRDLRDVLERSSARETAARVAVGAFCKQLLQQVGVSLFSYVKVIGGERAESRTFDSLQEAQAVVDASPVRTLDEAAALRMMRRIDEAKANGDSIGGIVCTEVHGVVPGLGSYVQYDRKLDAKIAQAVMSVNAFKGVEFGEGFEMAYRPGSEVMDPIAYGDNGYTRLSNHLGGFEGGMTTGMPILCSAVMKPIPTLYKPLQSVDIDTKEAFLAQIERSDSCAVPAASLVVEAVIAFEIAKEMCETFGHDTMERIKHRVDEYREELRVW

aroC

Chorismate synthase

387 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.827 kDa

MLRFLTAGESHGPALTAIVEGMVAGLPVTHEYINTQLARRQGGYGRGGRMKIEKDEVQFLSGIRGGYTTGSPITLQIANRDWQNWCHIMASGPDALLDERVVTRPRPGHADLPGAIKYDHSDIRNILERSSARETAARVAVGSMARCLLEELDIKLVGFVCSIGSIKASVAENLSIEDLVARTQSSQLFCPDEQAEEAMVKEIDQAKETGDSLGGVFEVRVYGVPVGLGSHVQWDRKLDSRLAGAMMGIQAIKGVEIGLGFGAAAVPGSQVHDEIYYAAQRGFYRGSNRAGGIEGGITNGEPLILRAAMKPIPTLYKPLRSVDIKNKEPYLASVERSDVCAVPAACVVGEAVVAWELAVALMEKFGGDSLGEIKARLNQWQQWVRQV

aroC

Chorismate synthase

387 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.186 kDa

MNRLRYLTAGESHGPSLTAIIEGMPANLELNEGDINRDLARRQLGYGRGGRMLIEKDKVNFTSGVRWGKTLGSPITLSIQNRDWENWGKKMSPVAEDFVEGMAITHPRPGHADLTGVIKYRQDDARNILERSSARETAARVAVGALCKKFLADLGMSVLGYVSELGGVCADASLEDYHERFALSEESPCRTFDAEAEQRMIKAIDRAKEDGDSLGGVVEVAVLGAPVGLGSYVQWDRRLDGRLAYAMMSIQAFKGVEIGLGFEAGRRPGSQVHDEIFHQGDEFVRKTNRAGGLEGGMTNGAPIIVRGAMKPIPTLYQPLQTVDFRTKDAFAAVVERSDVCAVPAAAVVAEAVVAIEMAQAMLEKFGGDAMEEVKQNLQAYGEYVQRF

aroC

Chorismate synthase

386 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.436 kDa

MLRYLTAGESHGPALVSVVEGVPAGLPLTAEYINRQLGRRQRGYGRGARMKIEGDAVKFLSGLRDGLTLGSPIALLVENKDWANWSEIMSTHPGARTDEKAVTRPRPGHADLAGAIKYRHADLRNVLERSSARETAARVAAGSVARRLLEELGIRIIGQVISVGGVEAGPLSLAPEELEARLEKSELFCADQAAERRMMAAIDSAREAGDTVGGVFEIRAYGVPPGLGSYVQWDRRLDGRLAAALMSIQAVKGVEVGMGFAAARKTGSQVQDEIFYEQGRGFYRRTNRAGGMEGGVSNGEPLVLRAAMKPIPTLRRPLQSVDLITKEPSSAAVERSDVCAVPAACVIGEAAVAWELAGACLEKCGGDSLAELKDNWDRYLSYVRQV

aroC

Chorismate synthase

386 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.328 kDa

MNTLGRLFRVTTWGESHGPALGAVVDGCPAGLPLSEDDVQRELDRRRPGQSGVSTPRSERDRVEILSGVHEGRTLGTPISMIVWNEDVDSSKYEPIRTRPRPGHADVTYRWKYGHVDYRGGGRASGRTTVGIVMGGAVAKKLLREAPSNDPLGIEIVGHVVRVGSVEADPGDLSAEEIMQYAESNPVRCADPDAAEEMLGEIERARENGDSVGGTIEVIAENVPPGLGDPVFGRLDGELAGALMNIPAVKAVEVGSGVRCSEMHGSEHNDPIWWDGHPVVDGDNSGGVLGGISHGGRLVVRVHVKPTPSVSVPQRTVDLESEEEVEIEVEGRHDPCICPRAVPVAESVVAIVLADAVLRAGYVNPDSVELPAASVEDRWRTLKRHL

aroC

Chorismate synthase

385 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.661 kDa

MSGSTFGLLFCVTNFGESHGPAIGCVIDGCPPGMALGEADIQPDLDRRRPGTSRHVTQRNEPDQVEILSGVYEGRTTGTPICLLIRNTDQRSKDYGNILDTFRPGHADYTYWRKYGLRDPRGGGRSSARMTAPMVAAGAVAKKWLREQHGITFTGWMSALGELPIPFEDESQIPLNPFYAPNAAVVPQLEAYMDALRKSGDSVGARIEVRARGVPAGLGEPLYDKLDADIAYAMMGINAVKGVEIGAGFASVAQRGTQHGDELTPAGFASNNAGGVLGGISTGQDLVVSIAIKPTSSIRSPKASIDRAGAPTVVETLGRHDPCVGIRATPIAEAMLALVVMDHALRQRAQCGDVQLPIPPLAAQAPRTETAPATPPLDAGDDIEA

aroC

Chorismate synthase

385 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.398 kDa

MIRFTTAGESHGEGLFVIIEGIPAGLTINSEDIDLELARRQKGYGRGQRMCIETDTVKVFSGMRHTVSLGSPIAMYIANKDFKNWTKIMSPTSVDSEVTPLLRPRPGHADLPGFMKYGVNDFRDILERASARETAARVAAGAVCKALLKEFEISIVSYTSQIGDVTADISSVEECKIWHDAEISCVRCPDAKASEKMIQLIKKAGEKGDTLGGKVVVVTKNVPAGLGSHTQWDLKLDGRLAQSLISIQAVKAVEFGAGTKLASLLGALSHDEIFYDVTRGFYRDTNRAGGIEGGMSNGEPIVVTCTMKAIPSLANPLHSVNLATKETAEAEAIRSDVCAVPAVGIVAEAAIAVELAKALKEKFGGDSLKDMKKNVNIYKERIKAL

aroC

Chorismate synthase

384 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.957 kDa

MRYMTAGESHGKGLSVIIEGIPSGLIIDFDQVQREMTRRQGGYGRGRRMQIEQDAVDVRGGIRHGYTTGAPISLFIENKDHTHWTKVMQAEPLQEELERPRTLTRPRPGHADLVGGLKYGHRDLRDVLERSSARETAARVAVGAIAKQLLGQLGIDVFSHVRSIGGIDADFVNPMEYREVIEASPVRCADEAAAERMMAAIDQAKKDGDTLGGEVEVVVTDMMPGIGSFTQNETKLDSRIARAVISVNAMKAVGFGDGFDLARRKGSTVQDEILHDETGYFRKTNHLGGIEGGMSTGMPIRVQVAMKPIPTLYRPLQSVDIETKEPFVAQVERSDACAVPAAAVVLEAVVAVEIAAAVLEMFGTSTLDRLKQAVTAYREEVRLF

aroC

Chorismate synthase

384 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.764 kDa

MLRYLSAGESHGKGLIAIIEGLPSNIPMDINRINADLGRRQQGFGRGNRMKIEKDRVEILSGVRDGKTLGTPLTLMIENLDYKNWTSIMSVEKLEKQNIIVEPRPGHGDLVGSLKYNHKDIRNVIERTSARDTAIRTAIGAVVKQFLSIFDIEILSHVISIGRAHYVPFVEDLFQYKSQIEASPVRCLNPTIEERMMGEIQRAKETGDSLGGVFEVIVRNVPIGIGSYAHFDRKLDGILAQGLMSLQAIKAVEIGNGIEGSSKMGSQFHDEIKYSEAKGYYHDTNRAGGIEAGVSNGEDILIRGYMKPIPTLMKPLKTVDMGTKEVKEAIIERSDNCAVPSAAVVAEGICAFAIAKEFLEKFRGDSIEEVEWNYERYMNYLRSR

aroC

Chorismate synthase

384 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.057 kDa

MFRYLTSGESHGEGLYVILEGVPAGLKVDLDYINHELSRRQLGYGRGERMKIEKDEAQILTGVRGGFATGAPITIKVKNRDYENWEKFMRTTGEIEPGREVTVPRPGHADLAGGLKYGHKDLRNVLERASARETAVRVAAGAVAKLFLAEFGVRIYSHVLRIGSVEVEYPGGLPEEELKKADEHPLRCLDAQVEGRMLKWVDRARENGDTLGGIFEVVVFGLPPGLGSYVHWDRKLDGRLAGALMAIPSAKGVEIGDGIALANIPGRMAVDEIYYENGHFYRKTNKAGGLEGGVTNGMPLIAKVSLKPIPTQVKPLKSVDIVTKETKPAQVERSDITAVPAAGVVGEAVTALVLMESFLEKFGGDRIEETKRNYQNYLQSIANY

aroC

Chorismate synthase

383 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.588 kDa

MRFLDAGETHGKALIAIIEGFPAHVKIDIENINHLLQLRQRGYGRGKRMEIEKDRVKILSGVRNSFTTGAPITLMIENRDYENWRSFMDATQCDVDTKKVTVPRPGHADLAGCLKYEFDDARNVLERASARETAIRVAVGAVCEELLKMFGIKLYNHVVEIGRVRLTKSYSFDDTELFEQALSSSDLFCIDKEAEMKMKEEIDIAKQIGDSVGGIAEVICKNVPYGIGSHVHWDRKLDAQIAHSVMSIQSVKGVEIGMGFEAARRFGSEVHDEIYYDDKKGFYRKTNNAGGIEGGISNGMDIVVRAAFKPIPTLYKPLKSVDIRTFQPAEAAVERSDICAVPAGSIVMRAAIAYVLANALIERLGGDSAKTMLETFKRIYNKG

aroC

Chorismate synthase

383 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.608 kDa

MLRYLTAGESHGRGLSVIVEGLPAGVPLTDGDINTWLTRRQGGYGRGGRMAIERDQAEILAGVRGGLTLGSPIALFIANRDWENWQEIMAPGPEARAARVVTRPRPGHADLAGGLKYHQADLRNILERASARETAARVAAGAVAAVLLKELAIELAFHVVRIGPVEVREQVDWEAACRAVESPVYCADPEAGRAMVAAIEEARQQGDTLGGVVEVLARGVPAGLGSHVHWDRRLDGRLAQALMSIPAIKGVEIGAGFRVAALPGSRAHDAIAYRKGQGFYHPTNRAGGLEGGLTNGETLVLRAAMKPIPTLMHPLPSVDLVTKQPATASIERSDVCAVPAAAVVAAAAVAWVLAGAILEQFGGDYLPVIQERLAAYRQYLQEI

aroC

Chorismate synthase

383 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.823 kDa

MRFLTAGESHGPELLAIIEGLPAGLPLSEEDINPWLEKRQKGYGRGRRMVIERDRVEFRAGVRGGRTTGAPVALAIKNADFKNWAEIMDPAPGNWPRKRALTAARPGHADLAGGMKYGHKDLRDVLERASARETAMRVAVGAVALKLLSLLGVEGVGYVPGMAGVWAKVPFSWDLVPRIEESPLRMTDPEAEAEAIRRIDQAKAEGDTLGGIIEARFRGLVPGLGSHVHWDRKLDGRLAQMALSIPAVKGVEIGPAFENAMKRGSEVHDAIYWSPERGFYRETNRAGGLEGGMTTGEELVVRAALKPIATLMKPLPTVDVVTHEPKDAARERSDTTAVPAASVILCALSAIVLAQAYLEKFGGDTMEEIQERVERYRERVRAY

aroC

Chorismate synthase

383 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.822 kDa

MRFLTAGESHGPELLAIIEGLPAGLPLSEEDINPWLEKRQKGYGRGRRMVIERDRVEFRAGVRGGRTTGAPVALAIKNADFKNWAEIMDPAPGNWPRKRALTAARPGHADLAGGMKYGHKDLRDVLERASARETAMRVAVGAVALKLLSLLGVEGVGYVPGMAGVWAKVPFSWDLVPRIEESPLRMTDPEAEAEAIRRIDQAKAEGDTLGGIIEARFRGLVPGLGSHVHWDRKLDGRLAQMALSIPAVKGVEIGPAFENAMKRGSEVHDAIYWSPERGFYRKTNRAGGLEGGMTTGEELVVRAALKPIATLMKPLPTVDVVTHEPKDAARERSDTTAVPAASVILCALSAIVLAQAYLEKFGGDTMEEIQERVERYRERVRAY

aroC

Chorismate synthase

383 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.847 kDa

MNGNRFGRMFQVTTYGESHGDAMGVTVSGCPAGLELEEADIQAELDRRKPGQSMITTSRGEPDAVEINSGVQDGYTTGTPIGMVIENKDARSGKYEPYVTAPRPSHGDFTYSAKFGTRNWGGGGRSSARETVNWVAAGAIAQKILTEYGIKAKAHVNQIGDIKAPPVTFEEMLEHTEENEVRCAHPETAERMRERIDEYQTEGDSIGGSIYFEARGVPAGLGAPRFDSLPARLGKAMFSVPATTSVEYGLGHEAREWRGSNRNEDWEFDEDGNPIPEGNTHGGLQGGITTGQPIYGEATWHAPTSIPKEQQTVDWETGEQKDIQVVGRHDPVLPPRAVPVVEAMLNITILDFMLLDGQINPDRLDDNPGQYETEYHPSSPQTN

aroC

Chorismate synthase

382 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.121 kDa

MRYLTAGESHGPQLTAIIEGLPSQLPLGTSDINPWLRKRQGGYGRGRRMVIETDEAQILSGVRAGRTTGAPVTLVIANKDHRNWTEIMSPEPGGEPRKKALTAARPGHADLTGGIKYRHKDLRDVLERASARETAARVAVGAVALKLLSELGVEGANYVASLGGIETRAPFSWDQLDAIEASDLRTPDADAAAQMRERIDQAKKDGDTLGGILEVRFRGLPVGLGSYVHWDRKLDGRIAQACLSVQAMKGVEIGRAFENAVQPGSRVHDAVYYREGTYVRDTNSAGGLEAGMTNGEELIVRVAMKPIATLMKPLPTVNVVTHEAADAARERSDTTAVPAAGVILQCVIGWVLAEAMLEKFGGDTLPELQERVQAARAYAQAY

aroC

Chorismate synthase

382 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.163 kDa

MRYLTAGESHGPQLTAIIEGLPAQLPLGKADIDPWLRKRQGGYGRGRRMVIETDEAELLSGVRAGRTTGAPVTLAIQNKDHRNWTEIMSPEPGGEPRKKALTDARPGHADLTGGIKYRHKDLRDVLERASARETAARVAVGSIALKLLSELGIEGANYVFNLAGIETRQAFSWDALDAIEDSDLRTPDADAAAQMRERIDQAKKDGDTLGGILEVRFRGLPVGLGSFVHYDRKLDGKIAQACLSVQAMKGVEIGRAFENAVKPGSGVHDAIHYREGTYARDTNGAGGLEAGMTNGEELIVRVAMKPIATLMKPLPTVNVVTHEASDAARERSDTTAVPAAGVILQCVIGWVLAEAITEKFGGDTLPELQERLAAARRYAAEY

aroC

Chorismate synthase

382 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.907 kDa

MRYLTAGESHGPKLVGILEGVPSGAKIDKETIDQALQERQKGPGRGGRMKIEKDQITILSGVRGGLTTGAPIALEIINRDWANWEKIMAWGDEADLESRKVMTPRPGHADLTGYLKYRTEVRNVLERASARETAMRVAIGNIAVQILEALGVEIRGQVLSVGKVHMDSEDTPEYWQRVQASEWKVGDPKGEEALDAQLQEARSQGESLGGVLQIQVRNLLPGLGSYVQWDRKLDGRLAQAVLSVQAIKGVAFGMGFTAGQHFGSEVHDPIGYDSGRGYYRYSNNAGGIEGGMTNGEPVIIEAVMKPIPTLYSPLSTVNLETKEVMEASVERSDVCAVPAALVVLKHVAAWEILQAILEKFPADTWDELDKAWQDYKRFVSEQ

aroC

Chorismate synthase

382 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.905 kDa

MRYLTAGESHGPKLVGILEGVPSGAKIDKETIDQALQERQKGPGRGGRMKIEKDQVTILSGVRGGLTTGAPIALEIINRDWANWEKIMAWGDEADLESRKVITPRPGHADLTGHLKYRTEVRNVLERASARETAMRVAIGNIAVQILEALGVEIRGQVLSVGKVHMNSEDTPEYWQRVQASEWKVGDPQGEEALYTQLQEARSKGESLGGVLQIQVQNLLPGLGSYVQWDRKLDGRLAQAVLSVQAIKGVAFGMGFAAGQHFGSEVHDPIGYDSGRGYYRYSNNAGGIEGGMTNGEPVIIEAVMKPIPTLYSPLSTVNLETKEVMEASVERSDVCAVPAALVVLKHVAAWEILQAILEKFPADTWDELDKAWHDYKRFVSER

aroC

Chorismate synthase

381 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.221 kDa

MRFLDAGETHGRCLVGIIEGFPANVKINIDNINRLLELRQRGYGRGKRMEIEKDKATILSGVRNSYTTGAPITIMIENRDYVNWQKYMDPILCDTMTKKVTVPRPGHADLPGCLKYGFDDARPVLERASARETAMRVAIGALCEELLNVFGIKLYNHVVEIGGVRIKKEYSTDDVNLFEEAENSDLFCIDKEAENDMKQVIDSAKEAGDSVGGVAEVICKNVPFGLGSHVHWDRKLDGLLAQAVMSIQSVKGVEIGMGFEVSRRFGSEVHDEIFYDDQKGFYRKTNNAGGIEGGISNGMDIVIRAAFKPIPTLYKPLRSVDLQGLKEKEAAVERSDTCAVPAGSVVMRAAVAYVLANSLIDRLSGDSLDIMIDNYKRLYQK

aroC

Chorismate synthase

381 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.44 kDa

MTLRYLTAGESHGPALVAIAEGFPAGLAVDFEAVDRDLRRRQKGYGRGGRMKIETDAAQFLAGLRGGLTTGAPIALAVWNKDHENWKDLVSPYARGGKKFTQVRPGHADLAGALKYGLDDARDVLERASARSTAVTVALGALAKALLSTLGVEVCSRVVAIGPREIRPDAPPTPAQRDAIEASDLHVDDEALAAEWRALIDAEKARGGSIGGAFDVYATGLPIGVGSHVHPDRRLDARLAGALCGVQAIRAVEIGDGTQVGRPGYEFHDAIHHDPARGFWRDTNRAGGLEGGMTDGMPLRVRAYMKPIPTMLHPLATVDLATRAATQARYERSDVCAVPAAAVVGEAVVAWELANALLEKFGGDAVEDVRRAVEAYAARIR

aroC

Chorismate synthase

381 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.537 kDa

MTLRYLTAGESHGPALVAIAEGFPAGLPVDFEAVDRDLRRRQKGYGRGGRMKIETDAAQFLAGLRGGVTTGAPIALAVWNKDHENWKDLVSPYARGGRKFTQVRPGHADLAGALKYGLDDARDVLERASARSTAVIVALGALAKALLSSQGVEVCSRVVAIGPRDIRPDAPPTPAQRDAIEASDLHVDDEALAAEWRALIDAEKARGGSIGGAFDVYATGLPIGLGSHVHPDRRLDARLAGALCGVQAIRAVEIGDGTQVGRPGYEFHDAIHHDPARGFWRETNRAGGLEGGMTDGMPLRVRAYMKPIPTMLHPLATVDLATRAATQARYERSDVCAVPAAAVVGEAVVAWELANALLEKFGGDTVEDVRRAVEAYAARIR

aroC

Chorismate synthase

381 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.599 kDa

MTIRYLTAGESHGPGLVAIAEGFPAGLAVDFDEVNRDLRRRQKGYGRGGRQKIEKDEAEFLAGLRGGVTLGAPIALVVWNKDHESWKDLVSPYARGGRPFTQVRPGHADLAGALKYALTDARDVLERASARSTAVTVALGSLAKQLLARFGVRVSSRVVAIGPRLRHVEEPPTDAERDAIEASDLHVEDEAVAAEWRALIDAEKARGGSIGGAFDVHATGLPIGLGSHVHPDRRLDARLAGALCGVQAIRAAEIGDGTQVGRSGPEFHDAIQHDPARGFHRPSNRAGGLEGGMTDGMPLRVRAYMKPIPTMLTPLATVDLATREATQARYERSDVCAVPAAAIVGEAVVAWELANAFLEKFGGDALVDVEKAVEAYAARIR

aroC

Chorismate synthase

381 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.482 kDa

MTLRYLTAGESHGPALVAIAEGFPAGLAVDFEAVDRDLRRRQKGYGRGGRMKIETDAAQFLAGLRGGLTTGAPIALAVWNKDHENWKDLVSPYARGGRKFTQVRPGHADLAGALKYGLDDARDVLERASARSTAVTVALGALAKALLSTLGVEVCSRVVAIGPREIRPDAPPTPAQRDAIEASDLHVDDEALAAEWRALIDAEKARGGSIGGAFDVYATGLPIGVGSHVHPDRRLDARLAGALCGVQAIRAVEIGDGTQVGRPGYEFHDAIHHDPARGFWRETNRAGGLEGGMTDGMPLRVRAYMKPIPTMLHPLATVDLATRAATQARYERSDVCAVPAAAVVGEAVVAWELANALLEKFGGDAVEDVRRAVEAYAARIR

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.952 kDa

MGGNTIGKMFSVTTWGESHGKAIGAVIDGCPAGLPLSEEDLLVELSLRRPGRRFTTPRREPDVPEILSGVFNGKTTGMPISIIIRNRDVISSYYEKIKETPRPGHADLAYIKKYGYEHWDYRGGGRASGRETAARVAAGAVAKKLLGCLGVVVSGYVVELGGVEFPSAEDAEESLRSRLSPFRVLCCEEKAEEVLKEALERRDSVGGVVEAVAWNAPAGLGEPVFDKLKADLAKAMMSIPASVGFEVGWGFKLARLRGSEARDKIVSSAGEATVEGDKAGGMLGGISVGAPIRIRVAFKPTSSIMIPEKTVNIHTLEETEVEVPGRHDPAIVLRAVSVVESMFAIVLVDHAIRAGLLNPVRVEWGPHCQRVWELYADRVP

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

42.128 kDa

MFRLLTAGESHGKSLVGVIEGFPANVKIDIEEINRDLGRRQRGYGRGGRMKIEKDRVEILSGVRGGKTLGSPISFLIENKDYANWEPYMNPEAVDGEEKRVTQPRPGHGDLTGTLKYGFDDIRNVLERSSARETAVRVAIGSLAKQLMREFHIEVYSHVTAIGSVSLGEPVENIEKIKRAEDSEVRCLDPEVEKAMIEEIKRAKEEGDSLGGIFEIHVTGVPRGLGSYVQWDHKLDAKLAHALMSIQAIKGVEVGCGFDQAQKKGSQVHDEIFFSQEKDYYRKTNYAGGIEGGMSNGENIHLRCAMKPIPTLYKPLRTVDIETKEAVLATVERSDSCAVPAASIVGEMVAITVIAQEFLKKFGSDSLEEIRKTWKSYTSI

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.454 kDa

MPSSWGKIFKVGTFGESHGKSVGVIVEGVPAGIPIRLEEIQKDLDRRRPGQSNLTTPRDENDTVRVVSGVFEGKTIGSPIALVVENQNTNSKDYENLRTTYRPSHADYTYQMKYGFRAHVGGGRSSVRETIGRVAAAAIARMILKDDLGIETVAWVDSIGTIQSTIGEKYPKSREEVDQNEVRCPDAVSADQMRSLILKMKEAGDSVGGTIKCVSYNLPPGLGDPVYDKLDGDLAKAILSIPACKGFEVGSGFSGTLLTGSSHNDEFYVEGGTGKVRTKTNNSGGLQGGISNGEELVIRAAFKPTSTIFKKQNTINLKGEETTLEAKGRHDPCVLPRAVPIIEAVVNLVLVDAYLYQRAINPQWFQKWARIPDYYKDLEL

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.454 kDa

MPSSWGKIFKVGTFGESHGKSVGVIVEGVPAGIPIRLEEIQKDLDRRRPGQSNLTTPRDENDTVRVVSGVFEGKTIGSPIALVVENQNTNSKDYENLRTTYRPSHADYTYQMKYGFRAHVGGGRSSVRETIGRVAAAAIARMILKDDLGIETVAWVDSIGTIQSTIGEKYPKSREEVDQNEVRCPDAVSADQMRSLILKMKEAGDSVGGTIKCVSYNLPPGLGDPVYDKLDGDLAKAILSIPACKGFEVGSGFSGTLLTGSSHNDEFYVEGGTGKVRTKTNNSGGLQGGISNGEELVIRAAFKPTSTIFKKQNTINLKGEETTLEAKGRHDPCVLPRAVPIIEAVVNLVLVDAYLYQRAINPQWFQKWARIPDYYKDLEL

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.574 kDa

MPSSWGKIFKVSTFGESHGTSVGVVVEGVPAGIPIRLEEIQKDLNRRRPGQSNLTTPRDETDTVRVVSGVFEGKTIGSPIALIVDNQNTISKDYENLRTTFRPSHADYTYQMKYGFRAHVGGGRSSVRETIGRVAAAAIARMILKDDLGIETIAWVDSIGTVQSNIGDKYPKSREEVDQNEVRCPDVGSADQMRSLILKMKEAGDSVGGTIQCVSYNLPPGLGDPVYDKLDGDLAKAILSIPACKGFEVGSGFSGTLLTGSSHNDEFYVEEGTGRVRTRTNHSGGLQGGISNGEELVIRAAFKPTSTIFKKQNTINLKGEETILEAKGRHDPCVLPRAVPIIEAVVNLVLIDAYLYQRAINPQWFQKWARIPDYYKDLEL

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.574 kDa

MPSSWGKIFKVSTFGESHGTSVGVVVEGVPAGIPIRLEEIQKDLNRRRPGQSNLTTPRDETDTVRVVSGVFEGKTIGSPIALIVDNQNTISKDYENLRTTFRPSHADYTYQMKYGFRAHVGGGRSSVRETIGRVAAAAIARMILKDDLGIETIAWVDSIGTVQSNIGDKYPKSREEVDQNEVRCPDVGSADQMRSLILKMKEAGDSVGGTIQCVSYNLPPGLGDPVYDKLDGDLAKAILSIPACKGFEVGSGFSGTLLTGSSHNDEFYVEEGTGRVRTRTNHSGGLQGGISNGEELVIRAAFKPTSTIFKKQNTINLKGEETILEAKGRHDPCVLPRAVPIIEAVVNLVLIDAYLYQRAINPQWFQKWARIPDYYKDLEL

aroC

Chorismate synthase

380 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.578 kDa

MMTSTFGTTVKVSIFGESHAPKIGCTIEGLPAGFTVDLHELKTFLQRRSPSHPWDTPRKEIDNPKFVSGISAKGILDGFPLTAELPNNNVRQKDYTATKLVPRPGHADFSAWAKWGNSYKQTGGGHFSARLTAPLCIAGGIALQILHAQGITIAAHVLKIKNINDTPFKLIDNSVEANKLLALQMNQLLQAAPQELPFLDAQTGEKTRALLTQLRSEKNTVGGIIECVATGVPAGIGCPHFQGLENTISAAVFGVPAVKAIEFGSGMNVANLLGSENNDAYEVRDGSVVPTTNHAGGILGGISTGAPIWFRCALKPISSIGLSQHSVNLQTMESEQLVVQGRHDVTAVLRAVPCVESAFALALLDTLYSWPSEQNGYHND

aroC

Chorismate synthase

379 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.252 kDa

MAGNSFGTLFRFTTFGESHGPAIGCIVDGVPPRLPLDEAFIQGFLDRRRPGQSRFVTQRQEPDAVRILSGVFEGLTTGTPVMLEIVNQDQRSRDYGEIRDRFRPGHADWTYQAKYGIRDHRGGGRSSARETASRVAAGAVARRVLETAPAPVTVRGALVQVGPHRVDRARWDWAEVERNPFFCPDAGTAALWADYLDGVRKAGSSIGAVVEVVASGVPAGWGEPIYDKLDGDLARAMMTINAVKGVEIGAGFAAAELSGEENADEMRAGPDGQPLFLSNRAGGILGGISTGQDIVVRFAVKPTSSILTPRRTIDTAGHETEIVTKGRHDPCVGIRAVPVGEAMMACVLADHFLRHRALVGAPGPVGNGGPVEDGDPVGG

aroC

Chorismate synthase

378 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.328 kDa

MANGNSFGVLFCVTTYGESHGGAVGVVVDGCPPRLPLSEADIQAELDRRRPGQSHITTPRQEADRCQILSGVFQGFTLGTPIHILVRNQDARPQDYSEMATTFRPSHADATYQAKYGIRNWQGGGRASARETIGRVAAGAIAKKILRLAAGVEILAYVQRVQDVEAQVDPSSVTAEQVEANIVRCPDPAAAAAMIEKIEAAAREGDSLGGVVECVARNVPRGLGCPVFDKLEADLAKAVMSLPASKGFEIGSGFAGTYLTGKQHNDEFYMTPSGWRTRSNRSGGIQGGISNGEDIVLRVAFKPTATIRQPQSTVTLDGQETVLAARGRHDPCVLPRAVPMVEAMVALVLCDHLLRHHAQCRSLALPEVPIPAVPLPHS

aroC

Chorismate synthase

378 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.291 kDa

MANGNSFGVLFCVTTYGESHGGAVGVVVDGCPPRLPLSEADIQAELDRRRPGQSPITTPRQEADRCQILSGVFQGFTLGTPIHILVRNQDARPQDYQEMATTFRPSHADATYQAKYGIRNWQGGGRASARETIGRVAAGAIAKKILRLAAGVEILAYVQRVKDVEAQVDPSSVTAEQVEANIVRCPDPQAAAAMIQKIEEAAREGDSLGGVVECVARRVPRGLGSPVFDKLEADLAKAVMSLPASKGFEIGSGFAGTYLTGKQHNDEFYMTPGGWRTRSNRSGGIQGGISNGEDIVLRVAFKPTATIRQPQNTVTLNGQETVLAARGRHDPCVLPRAVPMVEAMVALVLCDHLLRHHAQCGSLVLSEVPLPVAAAPQA

aroC

Chorismate synthase

378 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.22 kDa

MPSSWGKIFRVSTFGESHGTSVGVVVDGVPAGLPFPEEEIQKDLTRRRPGQNDLTTPRDEKDRMVVESGVFEGKTTGSPILMKVNNQNTIGSDYDEMAHVFRPSHADYTYSEKYGHRAHVGGGRSSVRETIGRVAAAGLARVILENELGISTVGFVDSIGPIDSNITEDEYPISRDLVDQFPTRCPKASANEEMETLIRKLRDEGDSVGGVVKVVVRNLPPGLGDPVYDKLDADLAKAILSISACKGFEVGSGFSGTRQTGSTHNDEFYIEEGTGKVKTRTNRSGGIQGGISNGMDLVIRAAFKPTSTIKKEQKTINDQNKETILKAKGRHDPCVLPRAVPIVEAVVNLVLVDAYLYQRALQPKWFMKYANLNAIPNQ

aroC

Chorismate synthase

378 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.22 kDa

MPSSWGKIFRVSTFGESHGTSVGVVVDGVPAGLPFPEEEIQKDLTRRRPGQNDLTTPRDEKDRMVVESGVFEGKTTGSPILMKVNNQNTIGSDYDEMAHVFRPSHADYTYSEKYGHRAHVGGGRSSVRETIGRVAAAGLARVILENELGISTVGFVDSIGPIDSNITEDEYPISRDLVDQFPTRCPKASANEEMETLIRKLRDEGDSVGGVVKVVVRNLPPGLGDPVYDKLDADLAKAILSISACKGFEVGSGFSGTRQTGSTHNDEFYIEEGTGKVKTRTNRSGGIQGGISNGMDLVIRAAFKPTSTIKKEQKTINDQNKETILKAKGRHDPCVLPRAVPIVEAVVNLVLVDAYLYQRALQPKWFMKYANLNAIPNQ

aroC

Chorismate synthase

378 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.254 kDa

MSGNTLGTLFCVTSFGESHGPAIGCVIDGCPPGLSLTAADIQGELDRRKPGTSRHVTQRREPDEVEILSGVFEGVTTGTPIALLIRNQDQRSKDYGNIAETFRPGHADYPYWQKYGIRDYRGGGRSSARETAVRVAAGAVARKWLSERYGIVIRGYMAQLGPLPIPFVSWDAVGDNPFFAPNAEIVPQLESYMDELRKSGDSVGARINVVASGVPVGWGEPVYDRLDADIAYAMMSINAVKGVEIGAGFASVAQLGTEHGDELTPEGFLSNNAGGVLGGISSGQDVLVSMAIKPTSSIRLDRRSIDREGNPVIVNTHGRHDPCVGIRATPVAEAMLALVLMDHALRHRAQCGDVRTATPQIAALAPEGVQAVPSPRAE

aroC

Chorismate synthase

378 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.615 kDa

MVTLMNTYGDMFRVTVFGESHGKAVGAVVDGCPANLPLSEEDIQKELDRRRPGQSIFSTPRKEEDKVEILSGIFEGKTTGAPICSIVYNKNMRPKDYSKIKDTPRPGHADLTYRLKYKNYDYRGGGRASGRVTIGHVIGGAIAKKLLSYTYNIKIIGYTIKIGKIEGDFSYYKNPEVFENEKSLERLIEIIESNPLRCPSMNEKEMEEYVLKAMENKDSVGGVVEIVALNVPVGVGNPIFNKLNGELARALMSINAVKGVEIGAGFKAAEMYGSEMNDEMYFDDDKNIRFKTNNCGGILGGISCGTPIVLRIAVKPTPSIGKKQKTINLKTLENVEIEIEGRHDPVIVPRIVPVAEAMVAITLADLMIKGGFIHPCSL

aroC

Chorismate synthase

377 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.467 kDa

MSGNSLGKLFCVTSFGESHGPAIGCVVDGCPPGMPISTQEIQVELDRRKPGTSRHVTQRREPDEVEILSGVFEGVTTGTPIALLIRNQDQRSRDYGNIAETFRPGHADYAYWQKYGIRDHRGGGRSSARETAVRVAAGAIARKWLNQQYGVVIRGFMSQLGPIEIPFVDWDEVGRNPFFAPNASIVPALEDYMDELRKSGDSVGARIDVVASGVPVGWGEPVYDRLDADIAYAMMGINAVKGVEIGAGFSSVAQRGTEHSDEMTPEGFLSNNAGGVLGGISTGQDILVSMAVKPTSSIRLDRRSIDKQGDAVVINTHGRHDPCVGIRATPIAEAMLAIVLMDHALRHRAQCGDVSCATPKLARLAPSGVQRVPAPPR

aroC

Chorismate synthase

377 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.106 kDa

MLNTFGDTFRVTTWGESHGKALGAVIDGCPSNLPLTENDIQYELNRRRPGYSLFSTPRKEEDEVEILSGIFEGKTTGTPISCIVYNKSQQSKDYTAIKDTPRPGHADLSYQLKYGNYDYRGGGRSSGRTTIGNVIGGAIAKKLIEYTHKIKVIGYTTEIGTIKGDFNYYNNPEFFESDLNIQKLSNQIEDSVLRCPSTNSNEMNEYVFKAIDGKDSVGGVVEVVIYGLPKGIGNPIFNKLEGRLSSAVMSINSIKGFEVGKGFESSRLFGSEMNDEFYFKNGIICPKTNNAGGILGGISTGAPVVIRASIKPTPSISKTQETVNIKTLETVPIKIGGRHDPIIVPRVIPVIESMVSITIADLMISSGFINPSKLSNI

aroC

Chorismate synthase

377 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.781 kDa

MSHNTFGHLFRVTTWGESHGPALGCVVDGCPPGVPLTEADIQPWLDRRRPGQGKFVTQRQEPDAVRILSGVFQDERTTAKFGGQVTTGTPISLIIENTDQRSRDYSEIATSFRPGHADYPYFAKYGVRDYRGGGRSSARETAARVAAGAIARKLLPGVTIRGAVVQIGPHAVDPGRIDFSVTGDNPFWAPDPEIVPVWERHLEQVRKAGSSTGAVVAVEATGVPAGWGAPLYGKLDAELAAALMSINAAKGVEIGAGFAAAALSGEENADEMRMGNEGPLFLSNKAGGVLGGISTGQPVTARVAFKPTSSILTPRRSLDEAGREIELRTKGRHDPCVGIRAVPVVEAMVACVLADALLRHRAQTGGGAHVLGENPKS

aroC

Chorismate synthase

376 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.75 kDa

MKLTIAGDSHGKYMVAILEGLPSGIRVDEELIRRDLFRRRNCYGRGKRMKMEEDAFEIVSGLWKGITTGAPVTILIPNRAGNPVKDVRSVPRPGHIDYAAWVKYKLPDLNIYVERSSARWTVALTAAGSLLKSLLKEFGIEVLGFVTRLGNVEARDIPGDFEELKRRRDESVVFCPDPEATKEMVAEIDRAKEEGNTLGGKVKVIARGVPAGIGSYSDLFKKLDSKIGSLFFAIPAVKGVVIGSEEMWYGFDYLDEFELEDGKIKRKTNNLGGIEGGITNGEDVWVNVSVKPIPTTGKPLKSVDLRTMEPAKTPYVRSDVTAVPPASVVCEAALAVVISDALLEHLGDGNIDDLKRRFENENLPRWNDGFWKEHYR

aroC

Chorismate synthase

376 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

41.564 kDa

MRLTIAGDSHGKYMIAVLEGIPAGLKIDEEIIRRELFRRRNCYGRGKRMSMEEDAFEIVSGVWGGITTGAPVTILVPNKAGNPVKDVRSVPRPGHIDYAAFVKYKLPDLNVYVERSSARWTVALTAAGALLKSLLREFNIDVLGFVTRLGNVEAKNIPDNFEELRRKRDESAVFCPDPEATEGMISEIDRAKEEGNTLGGKVKVIARGVPAGIGSYSDLFKKLDSKIGSLFFAIPAVKGVVIGSEEMWYGFDYLDEFELEDGRIKRRTNNLGGIEGGITNGEDVWVNVFVKPIPTTGKPLNSVDLRTMEPAKTPYVRSDVTAVPPASVVCEAALAVVISDALLEHLGDGNIDDLKRRFGNENLPRWDDGFWKEYDR

aroC

Chorismate synthase

374 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.589 kDa

MILCGDSVAGNSTGEMFRVTTFGSSHGPAVGAVIDGCPAGLELSEDDIQQELNRRRPGTGALTTPRAESDRVEILSGIFRGRTDGTPIAGIVRNLDADSKSYSNIKNTPRPGHGDYTWRARFRNYDYRGGGRGSGRVTIGHVIGGAVAKKLIGNYGLTVTGHVVQVGDVKADTVSLKRIGEYAESNPVRCADPRAARQMEKVILDARSRGDSVGGVVEVVVLGAPPGLGDPVFSKLDADMARALMGIGSVKGVEIGMGFEVAEHRASEINDEFYLDDDGKVRTTTNTSGGILGGISSGMPITARIAVKPTPSISVPQKTVDLERMEETTIEVRGRHDPCICPRVVPVAEAAVAIVLADHMIRAGFIHPTYIGNE

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.994 kDa

MSHNTFGHLFRVTTFGESHGPAIGCVVDGCPPLIPIDEADIQTFLDLRRPGTSRFTTQRQEADRVRILSGVFTDEASGKQVSTGTPIALLIENTDQRSKDYDAIKNLYRPGHADFAYDAKYGLRDHRGGGRSSARETATRVAAGAIARKVVADVTIRGALVQMGPHKINRDAWDWDETTRNPFFCPDAKAAAFFETYLDDIRKAGSSIGAVIEIVAENVPAGWGAPLYGKLDADLASGLMSINAVKGVEIGEGFDAAALSGEANADEMRIGSLGEPVFLSNHAGGILGGISTGQPLVMRFAVKPTSSILQPRHTIDRSGHESEIVTKGRHDPCVGIRAVPVGEAMVACVLADHFLRHRGQIGEGAVWPANRSR

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.796 kDa

MNTFGDNFRVTTWGESHGKALGAVIDGCPANLPISEQDIQNELNRRRPGYSIFSTPRKEEDKVEILSGIFEGKTTGTPISGLVFNKGQKSKDYSKIKDTPRPGHADLNYFLKYGNYDYRGGGRSSGRTTIGNVIGGAVAKKLIEFTHNIKIIGYSTKIGKIKGDFDYYKNPKFFESDSNIEKLLKKIENNPLRCPSKNSDEMKDYVIDAMDKKDSVGGIIEIIIKGIPQGVGNPVFNKLEGKLGSAFIGINAVKGFEIGRGFEASELYGSEMNDAYHIYENSIKEMTNNAGGIIGGISTGSPVVLRVSIKPTPSISKIQDSMNLISNKDEKIEIGGRHDPIIVPRVIPVLESMAAITVADLMISSGYINPCRI

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.808 kDa

MNTFGDNFRVTTWGESHGKALGAVIDGCPANLPILEEDIQNELNRRRPGYSIFSTPRKEEDMLEILSGIFEGKTTGTPISGLVFNKGQKSKDYSKIKDTPRPGHADLNYFLKYGNYDYRGGGRSSGRTTIGNVIGGAVAKKLIEFTHNIKIIGYSTKIGKINGDFDYYKNPEFFESDSNIEKLFEKTENNPLRCPSKNSDEMKDYVLDAMDKKDSVGGIIEIIIKGIPQGVGNPVFNKLEGKLGSAFIGINAVKGFEIGRGFESSDLYGSEMNDEYYIDENSINEKTNNAGGIIGGISTGSPVVLRVSIKPTPSISKIQDSVNLISNENEKIEIGGRHDPIIVPRVIPVLESMAAITVADLMISGGYINPCRL

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.977 kDa

MMSGSTFGTLFRVTTWGESHGRAIGVVVDGCPAGIELSEMDVQRELDRRRPGQSTATTERHEADSVEILSGIFEGITTGTPISMLVWNRDARSSHYDSIRHTPRPGHADYTYHVKYGIRDHRGGGRASARETVGRVAAGAVARKLLSEFGVEIAGYVSELGGISASLPRWTSRGSIEREELLDIRERAESSPIRCPDAAASSRMLSLLDSVRSDGDSIGGVVEVIAIGVPPGLGEPVFDKLDADLAKALMSIGAVKAVEIGAGFESARLRGSEMNDPLFYENGRISFERNNAGGILGGISTGAPILCRMAVKPTPSIARSQRTVDMVSGESVDISVRGRHDPSIPPRIVPVAEAMVALVLADHILRQRSARLR

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.913 kDa

MSGNTFGKLFTVTSFGESHGLGLGAIIDGCPPGLELTEADLQIDLDRRRPGTSRYTTARREADEVKILSGVFEGKTTGTPIGLMIENTDQRSKDYGNIADSFRPGHADYTYWQKYGLRDYRGGGRSSARETAMRVAAGAIAKKYLAEKFGMTIQACVTQIGDIVASGPKGAPFDVNTVDWSSVEDNPFFFPDETKIEQLGEYLRDIIKEKDSIGAKVTVVATNVPVGLGEPIFDRLDADIAHGLMSINAVKGVEVGDGFAVVNQKGSEHRDELTPEGFSTNHSGGVLGGISSGQQIIAHLALKPTSSIGVSGKTVNLTGEATDIITKGRHDPCVGIRAVPIAEAMLALTLMDHFLRHRGQNADVQCNTPDIEA

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.5 kDa

MNTIGKSFRITAWGESHGKALGAVVDGCPSNLPLTGEDIQKELNRRRPGYSLFSTPRKEGDKVEILSGIFEGKTTGTPISAIVYNTNQKSKDYSHLKNTPRPGHADLSYKLKYGNYDYRGGGRSSGRTTIGHTIGGAIAKKLLDYTHNIKIIGYTTKIGNIEGDFNYYNSIENNEKMINEELINKIENNPLRCPSSNADEMKDFVLNAMENKNSVGGVIELIALNVPVGVGNPIFGKLNGELSNAIMNINAVKGVEIGRGFESAELLGSEMNDEYYYDENNNIKLKTNNCGGVLGGISCGAPLVIRVAVKPTPSISAVQSTINIENKTTENLEIGGRHDPIIVPRVIPVLESMVAIALSDLMIRGGFIHPCKL

aroC

Chorismate synthase

373 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.811 kDa

MNTFGDNFRVTTWGESHGKALGAVIDGCPSNLPISEEDIQNELNRRRPGYSIFSTPRKEEDKLEILSGIFEGKTTGTPISGLVFNKGQKSKDYSKIKNTPRPGHADLNYFLKYGNYDYRGGGRSSGRTTIGNVIGGAVAKKLIEFTHNIKIIGYSTKIGKINGDFDYYKNPEFFESNSNIEKLFEKIENNPLRCPSKNSDEMKDYVLDAMDKQDSVGGIIEIIIKGIPQGVGNPVFNKLEGKLGSAFIGINAVKGFEIGRGFESSELYGSEMNDSYYMNKDSIKGKTNNTGGIIGGISTGSPVVLRVSIKPTPSISKIQESVNLISNENEKIEIGGRHDPIIVPRVIPVLESMAAITVADLMISSGYIDPCRI

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.694 kDa

MSHNTFGHLFRVTTWGESHGPALGCVVDGCPPGIALTAEMIQVFLDKRRPGNGKFVTQRQEPDAVRILSGVFEDARSNGQRTTGTPISLMIENTDQRSKDYSEIAQAFRPGHADYAYFAKYGVRDYRGGGRSSARETAARVAAGAVARLIIPGVTVRAALVQIGPHKIDRSNWDWAQTEQNPYWSPDAAIVPVWEEHLEKIRKAGSSTGAVVEVEATGVPAGWGAPLYAKLDAELAAALMSINAAKGVEIGDGFDSAALTGEDNADTMRMGDDGQPVFQSNHAGGILGGISSGQPIVARVAFKPTSSILIPRETVNEAGEEIELRTKGRHDPCVGIRGVPVVEAMTACVLADAFLRHRGQTGREHFPLGASA

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.694 kDa

MSHNTFGHLFRVTTWGESHGPALGCVVDGCPPGIALTAEMIQVFLDKRRPGNGKFVTQRQEPDAVRILSGVFEDARSNGQRTTGTPISLMIENTDQRSKDYSEIAQAFRPGHADYAYFAKYGVRDYRGGGRSSARETAARVAAGAVARLIIPGVTVRAALVQIGPHKIDRSNWDWAQTEQNPYWSPDAAIVPVWEEHLEKIRKAGSSTGAVVEVEATGVPAGWGAPLYAKLDAELAAALMSINAAKGVEIGDGFDSAALTGEDNADTMRMGDDGQPVFQSNHAGGILGGISSGQPIVARVAFKPTSSILIPRETVNEAGEEIELRTKGRHDPCVGIRGVPVVEAMTACVLADAFLRHRGQTGREHFPLGASA

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.545 kDa

MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGLTTGTPIALLIRNTDQRSKDYATIARQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAAVVAKKWLQQRYGVTVRGFLSQLGEIRPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGDSVGARVDVVAEGVPPGWGEPIYGKLDGELAAALMGINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIATGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCIPEGVGLRNADD

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.877 kDa

MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGRTTGTPIALLIRNTDQRSKDYATIARQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAGVVAKKWLKQRYGVIVRGFLSQLGEIRPEGFAWDAVEDNPFFWPQAAQVPELEAYMDALRKSGNSVGARVDVVAEGVPPGWGEPIYGKLDGELAAALMSINAVKGVEIGAGFGSTVQKGTEHRDLMTPLGFLSNHAGGIIGGITTGQPIIVSIALKPTSSLRLPGETVDVDGHPVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCILENVGFRNADD

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.615 kDa

MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGRTTGTPIALLIRNTDQRSKDYATIVRQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVTAGVVAKKWLKQRYGVIVRGFLSQLGEIRPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGNSVGARVGVVAEGVPPGWGEPIYGKLDGELAAALMSINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIATGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCIPEGVGLRNADD

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.545 kDa

MGANTFGKLLAVTTFGESHGPAIGCVIDGCPPGLELAAEEFAHDLQRRATGRSRHTSARREADEVEILSGVYEGLTTGTPIALLIRNTDQRSKDYATIARQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAAVVAKKWLQQRYGVTVRGFLSQLGEIRPEGFAWDAIEDNPFFWPHAAQVPALEAYMDALRKSGDSVGARVDVVAEGVPPGWGEPIYGKLDGELAAALMGINAVKGVEIGAGFGSAVQKGTEHRDLMTPLGFLSNHAGGIIGGIATGQPIIVSIALKPTSSLRLPGETVDVDGCAVQVITKGRHDPCVGIRAPPIAEAMVALVLMDQALRHRAQCGDVGEMSPCIPEGVGLRNADD

aroC

Chorismate synthase

372 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

38.671 kDa

MTGNTFGNAFRITTFGESHGPGLGVVIDGCPAGLPLTEADVQAELDKRKPGQSEVTTQRKEADMVEILSGVFEGLTTGTPIAMLVRNADARSAAYENIRNIARPGHADFGYMEKYGMRDYRGGGRSSGRETLSRVAGGAVAKKLLSLYGVEVHAHTVAIGNVRAKPATIEEIKANVWKNPVRCADLSAADAMLREVSAAREASDSVGGIVEIVATGVPAGVGTPAFDKLDACLAYALMGIGGVKAVEIGAGIASAGMRGSEMNDEFCTEDGKVRTKTNRCGGILGGISTGMPIVCRAAIKPTPSISRPQRTVNLETGAETIIEITGRHDPSIVPRAVPVAEAMVALVIVDQMISGGLINPVSAGAVDASRNR

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.826 kDa

MSGNTLGLLFTVTTFGESHGPAIGAVADGCPPGMLLTEADIQLDLDRRKPGTSRHVTQRKEEDKVEILSGVFEGKTTGTPIALLIRNTDQRSQDYGDILQTFRPGHADYAYQYKYGIRDPRGGGRSSARLTAPVVAAAVIAKKWLHEKYGTEFYGYMSQLGELEIPFKDASEIEKNPFFAANAELIPQLETYMDELRRAGDSCGARIEVRARNVPAGLGEPLFDKLDADIAHAMMGINAVKGVEIGAGFRSVVQRGSEHGDELHSDGFASNNSGGTLGGISSGQDLRVSIAIKPTSSIMSPKQSVDLSGKPIIVQTKGRHDPCVGIRATPIAEAMLALVLMDHVLRHRAQCADVSTSISPIPASQPGSFHD

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.53 kDa

MSHNSFGHLFRVTTFGESHGPALGCVVDGCPPLIPLEAAEIQAELDRRRPGQSRFTTQRREPDTVRILSGVFADDRTGGRQLTTGTPIALMIENVDQRSKDYSEIRDTYRPGHADYTYEAKYGIRDYRGGGRSSARETAARVAAGAIARKVLPGVTIRGALVQLGPHAIDRARFDWNEVGNNPFFCPDAVAAVQWAEILDEIRKDGSSIGAVIEVVAEGVPPGLGAPVYGKLDADLAAAMMSINAVKGVEIGDGFAAATLRGEENADEMRPGNGGAPAFLANHAGGILGGISSGQPIVCRFAVKPTSSILTPRASVTRDNRPAEVVTKGRHDPCVGIRAVPVGEAMMACVLADHYLRHRGQVGERAPFREG

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.786 kDa

MSHNSFGHLFRVTTFGESHGPAIGCVVDGCPPGLPLVEDDIQIFLDRRRPGQNRFMTQRQEADKVKILSGVFEDAQTGGQVTTGTPIALLIENTDQRSKDYEAIKDVYRPGHADYVYDAKYGVRDYRGGGRSSARETASRVAAGAVARKIIASVKIRGALVQMGPHKIDRAHWDWEEVDKNPFFCPDAAAARFFETYLDGVRKAGSSIGAVIEIVAENAPAGWGAPIYGKLDSEIAAALMSINAVKGVEIGEGFAAAELSGEDNADEMRSGNEGKPIFLSNHAGGVLGGISTGQPIVARFAVKPTSSILKPRQSIDRFGRESEIVTKGRHDPCVGIRAVPVGEAMVACVLADQFLRHRGQVGSGPAWPFPA

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.632 kDa

MSGNTLGLLFTVTTFGESHGPAIGAVVDGCPPGMTLSEADIQADLDRRKPGTSRHVTQRKEEDKVEILSGVFEGKTTGAPIGLLIRNTDQRSQDYGDILQTFRPGHADYAYHYKYGFRDPRGGGRSSARLTAPVVAAAAIAKKWLKEHYGTEFYGYMGQLGEIEVPFQDKKHIAENPFFAANSEIIPQLEGYMDELRKAGDSCGARIEVRASNVPIGLGEPLFDKLDADIAHAMMGINAVKGVEIGAGFKSVSQRGSVHGDDLHPDGFASNNSGGTLGGISSGQELRVAIAIKPTSSIMTPKHSVDIKGQPITVQTKGRHDPCVGIRATPIAEAMLALVLMDHALRHRAQCGDVELAVPPIPASRPGSQLD

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.621 kDa

MSGNTFGKLFTVTTFGESHGLALGAIIDGCPPGIELSEEDLQLDLDRRKPGTSRYTTQRKEADQVKILSGVFEGKTTGTPIGLLIENTDQRSKDYGKIKDQFRPAHADYTYMQKYGIRDYRGGGRSSARETAMRVAAGAVAKKVLANLWGIKIRGYLSQLGPIKAELLDWNEVEQNPFFCPDKSKVPEMEAYMQALNKEGNSVGAKITVVAENMIPGLGEPVFDRIDADLAHALMGINAVKGVEIGAGFACVAQKGTEHRDEITPEGFKSNQAGGVLGGISTGQDLIASLALKPTSSLRIPGQSVDIEGNPVEVITTGRHDPCVGIRATPIAEAMMALVILDHALRNRGQNGHVQSGVPIIPGSIPGQIGS

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.148 kDa

MSGNTFGKLFTVTTFGESHGLALGCIVDGCPPGLPLTEEDLQVDLDRRKPGTSRHTTQRREPDQVRILSGVFEGKTTGTPIGLLIENTDQKSKDYSNIKDQFRPAHADYAYWHKYGVRDYRGGGRSSARETAMRVAAGAIAKKFLQTVYGVRIRGYLSQLGPIKVEKVDWSIVNDNPFFCPDADKIPEMEKYMDALRKEGDSIGAKITVVAEGVPPGLGEPIFDRLDADLAHALMSINAVKGVEIGAGFDVVEQKGTEHRDEMTPEGFLSNNAGGVLGGISSGQDVIAHMALKPTSSLRLPGKSIDVNGDPVEVITTGRHDPCVGIRATPIAEAMMAMVLMDHLLRHRGQNADVKVDTPDIAAIARVKAQD

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.83 kDa

MSFNTFGHLFRVTTFGESHGPAIGCVVDGCPPGLRFTVDEVQAALDRRRPGQSRFTTQRREPDQVRVISGTMDHPEGGLVTTGTPIGLLIENVDQRSKDYADIAGSYRPGHADVTYDLKYGLRDHRGGGRSSARETAMRVAAGAIAAKVLPGVTVRAALTRIGEIEIDRARWDWAQVSENPFFCPDPETVPVWTDYLDGIRKRGSSVGAVIEVVAEGVPAGLGAPIYGKLDADLAAAFMSINAVKGVEIGEGFNAARLTGEENADEMRTGNDGRPYFLSNHAGGILGGISSGEPVVARFAVKPTSSILTPRRTVDKFGTEEDLITKGRHDPCVGIRAVPVGEAMMLCVLADHLLRHRGQVGTTPVWPFQRG

aroC

Chorismate synthase

371 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.73 kDa

MSHNTFGHLFRVTTWGESHGAALGCVVDGCPPGIRFTRDEIQAELDKRRPGQSRFVTQRREPDEVKVLSGFVLDEDGETMITTGTPVSMLIENVDQRSKDYGEIARQYRPGHADYTYDVKYGIRDYRGGGRSSARETAARVAAGALARKVVPGMVVRGALVSMGEKSIDRANWNWNFIGDAENPFFTPDPASVPVFTQYLDGIRKAGSSVGAVIEIVADGVPPGLGAPIYAKLDQDIASGLMSINAVKGVEIGNGFEAARITGEQNADEMRIGNDGKPVFLSNNAGGILGGISTGQAIVARFAVKPTSSILTPRKSIDKDGNDVEVMTKGRHDPCVGIRAVPIGEAMVACAIADHYLRHRGQTGKGIGSRE

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

38.941 kDa

MSMNSYGHLFRVTTWGESHGPALGATVDGCPPGIDVDAAAIQHWLDRRKPGQNKYTTQRREADEVEILSGVYEGQSTGTPIQLMIRNTDQRSKDYGDIAEKFRPGHADITYWQKYGIRDPRGGGRSSARETAARVAAGGVARLALAALVPAVKITGYMVQMGPHGIDRECFDLAQVDENPFWVPDAKAADEWAAYLDGLRKSGDSVGAVIEVRASGLPAGLGAPIYGKLDTDLAAAMMSINAVKGVEIGDGMAAAALTGSANADEIHMGDNGPEYSSNHAGGILGGISTGQDVIVRFAVKPTSSILTPRATITKAGTPAEIITKGRHDPCVGIRAVPVGEAMMACVVLDHILLQRGQIGGKVGETRGKIG

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.645 kDa

MSFNTFGHLFRVTTFGESHGAAIGCVVDGCPPNLRFTLEDVQAALDRRRPGQSRFTTQRREPDQVKVLSGTLEHPEGGLVTTGTPIALLIENVDQRSKDYADIAGAYRPGHADFTYDIKYGIRDHRGGGRSSARETATRVAAGAIAAKVLPGVTVRGAVVRIGEIEIDRSRWDWNEVPNNPFFCPDPKTVPLWEEYLDAVRKAGSSIGAVVELVAEGVPAGLGAPLYGKLDADLASALLGINAAKGVEIGEGFNAAQLTGEENADEMRLGNEGRPQFLSNHAGGILGGIATGAPIVARFALKPTSSILTPRQTVDRTGQETEIFTKGRHDPCVGIRAVPVGEAMMWCVLADHFLRHRGQVGESVAWPFKG

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.123 kDa

MSTTLGTKLKLTIFGESHGVAIGGVIDGILPGIKLDMDYIEAVMKRRMPGQNDMSTPRKEADKAEMLSGVFNGITTGAPIAFEIRNSNQHSSDYEKTKNLMRPGHADYTGYMKYKGYSDYRGGGHFSGRLTAVLTFAGAIASYILEGANIFITAHVLSIGEVIDENLNSMTGSAQLRDKLKQMELPVISEEKEIFMRNLIQDAKSNHDSIGGVVECAVTGVPAGIGNPFFDSVESRLSHMLFSIPAVKGIEFGDGFEMSKARASMVNDQMSIIDGEVTHKSNHNGGILGGITNAMPIIFKTAIKPTPSIAMSQNTVDINNSSDAIIEIKGRHDPCIVPRVVPVIESVAAFVILDMMLDESPEYIKSRWSL

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.51 kDa

MSGNTLGLLFTVTTFGESHGPAIGAVVDGCPPGMDLTEADIQGDLDRRKPGTSRHVTQRKEPDQVEILSGVFEGKTTGTPICLLIRNTDQRSKDYGNIVETFRPGHADYTYWQKYGIRDYRGGGRSSARLTAPVVAAGAVAKKWLREQFGTEIRGYMSKLGEIEVPFSDWSHVPENPFFAANADIVPELETYMDALRRDGDSVGARIEVVASNVPVGLGEPLFDRLDADIAHAMMGLNAVKGVEIGAGFKSVEQRGSEHGDELTAQGFRGNNAGGILGGISTGQDITVSLAIKPTSSIRTPRESIDKAGNAATVETFGRHDPCVGIRATPIAEALLALVLVDHALRHRAQCGDVKVDTPRIPAQAPGQPG

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.799 kDa

MSMNSFGHLFRVTTWGESHGPALGATVDGCPPNVAVSEEMLQHWLDKRRPGQNKNTTQRNEPDAVRILSGVFEGKSTGTPIQLMIENTDQRSRDYGEIAQTFRPGHADITYFQKYGNRDYRGGGRSSARETAARVAAGGVAREALKSLAPGIEIKGYMTRMGEMEIDRARFDWSAIDQNDFWIPDAAAVQDWEDYLQALRKQHDSVGAVVEVVARGVPAGIGAPIYGKLDTDLAAAMMSINAVKAVEIGEGMNAALLKGSENADEIFMGNDGAPVYSSNHAGGILGGISTGQDVVIRFAVKPTSSILTPRQSIRKDGTAAEVITKGRHDPCVGIRAVPVAEAMMAFVILDHILLHRGQIGENQGVIGAPD

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.442 kDa

MGNIFGHLFRVTTFGESHGGGVGVIIDGCPPKLEINVKEIQYELDRRRPGQSKITTPRKESDTCEILSGVFEGQTLGTPIMIWVRNKDARPQDYQDMAIKYRPSHADATYDAKYGIRNWQGGGRSSARETIGRVASGAIAKKILQQYSGVEIVGYVKRIKNLEAIVDPTTVTMEQVESNIVRCPDSECAEKMIELVEKIRDLGDSVGGVVECIVRNVPKGLGSPVFDKLEADLAKGVMSLPATKGFEIGSGFAGTTMTGSEHNDELYTDKLGEIRTVTNRSGGIQGGISNGENIVLRVAFKPTATIRKEQRTVSRQGEETFLAAKGRHDPCVLPRAVPMVEAMVAIVLCDHLLRHYGQCNTLKSENVYGN

aroC

Chorismate synthase

370 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.497 kDa

MSGNTFGTLFAVTNFGESHGPAIGCVIDGCPPGMELSEADIQGDLDRRRPGTSRHVTQRNEPDAVQILSGVYEGKTTGTPIALLIQNTDQRSKDYGQIAQQFRPGHADFTYWKKYGIRDPRGGGRSSARLTAPMVAAGAVAKKWLAEKYGMVFRGCMTQIGEIAIPFESWDHVPANPFFAPMADVSELEAYMDRLRKAGDSCGARIRVTAGNVPIGLGEPLFDKLDAEIAYAMMGINAVKAVEIGAGFESITQRGTTHGDSITPTGFVTNNAGGILGGISSGQDLEVSIAIKPTSSIISPRQSIDIHNNPVEVVTKGRHDPCVGIRATPIAEAMLALVVMEHVLRNRAQCGDVQTQAEKPESASPQASFL

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.318 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEDYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.265 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLCERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEDYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.318 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEDYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.318 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEDYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.26 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEGYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.26 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEGYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.26 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEGYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.26 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIAETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEGYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITRAGEPAVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSSATPRIAARAPDAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.273 kDa

MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADVQLELDRRKPGTSRHVTQRQEPDQVEILSGVFEGVTTGAPIALLIRNTDQRSKDYGNIVETFRPGHADYTYWQKYGVRDYRGGGRSSARLTAPVVGAGAIAKKWLRERFGVEVRGYMSALGEIEIPFVDWSHVRENPFFAPNADIVPQLEGYMDALRKDGDSIGARIDVVASGVPVGWGEPLFDRLDADIAHAMMGINAVKGVEIGAGFASVAQRGSVHGDELTPDGFVGNHAGGVLGGISTGQDITVSIAIKPTSSIRTPRRSITKAGEPAVIETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVSTATPKIAARAPQAQ

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.559 kDa

MSGNTLGLLFTVTTFGESHGPAIGAVVDGCPPGMSLTEADIQIDLDRRKPGTSRHVTQRQEADQVEILSGVFEGKTTGTPICLLIRNTDQRSKDYGNIVETFRPGHADYTYWHKYGIRDYRGGGRSSARLTAPVVAAAAIAKKWLNEQYGTEIRGYMSQLGEVEVPFTDWKHVPENPFFAANADIVPELETYMDALRRDGDSVGARIEVVASHVPVGLGEPLFDKLDADIAHAMMGINAVKGVEIGAGFDSVSQRGTVHGDELTPEGFRTNNSGGVLGGISTGQDIKVSLAIKPTSSIRTARESIDKAGSPASVETFGRHDPCVGIRATPIAEAMLALVLMDHALRHRAQCGDVRVDTPRIPAQAPGKS

aroC

Chorismate synthase

369 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.391 kDa

MSGNTLGLLFTVTTFGESHGPAIGAVVDGCPPGMALTEADIQGDLDRRRPGTSRHVTQRQEPDQVEILSGVFEGKTTGTPICLLIRNTDQRSKDYGNIVETFRPGHADYTYWQKYGIRDHRGGGRSSARLTAPVVAAGAVAKKWLREKYGTEIRGYMSQLGEIAVPFTDWSHVPENPFFAPNADIIPELETYMDALRRDGDSVGARIEVVASNVPVGLGEPLFDRLDADIAHAMMGINAVKGVEIGAGFDSVAQRGSVHGDELTAEGFRTNNSGGVLGGISTGQDVTVSLAIKPTSSIRTPRESIDKAGNAATVETFGRHDPCVGIRATPIAEAMLALVLIDHALRHRAQCGDVKVDTPRIPAQAGQTP

aroC

Chorismate synthase

368 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.106 kDa

MNTIGKLFRLTTFGESHGKAIGGVIDGCPAGLFVDMETIERELLRRRPGQSHYTSPRQESDMVQFISGLFRGETTGAPIAFMIDNKDVRSADYDSLSSIFRPGHADYTYFHKYGIRDTRGGGRSSARETAVRVVAGAVAKQLLAPLGIRCTAYTSQIGPVCIPQENAKEYSPEEVESSPIRCPDPNASGLMEAVIETAKKESDSVGGIVDCQISDVPVGWGEPLYGKLHAALGAAMLSINAAKGFEVGDGFALASMRGSEANDQMVAAEDGGISFLSNHSGGISGGISTGQDIRFRVAFKPTPTIGQKQQTVNEQGESISLSAVGRHDPCVVPRAVPVVEAMTWLTLADAYLASRSGRCAHSSLKCNG

aroC

Chorismate synthase

368 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.218 kDa

MSGSTLGHLFCVTNFGESHGPAIGCVIDGCPPGMSLSEADIQPELDRRRPGTSRHVTQRNEPDAVEILSGVHEGRTTGTPICLLIRNTDQRSKDYGNIVQTFRPGHADYTYWHKYGLRDPRGGGRSSARLTAPMVGAGAVAKKWLKEHHGIAFRGGMAALGEIDIAFEGWQHVPDNPFFAPNASQIGQLEDFMDALRKEGDSVGARIVVEATGVPVGWGEPLFDKLDADIAHVMMGLNAVKGVEIGAGFASVAHRGSMHGDELTPQGFRSNHAGGVLGGISTGQDIRVSIAIKPTSSIRTPRQSIDLQGQPATVETFGRHDPCVGIRATPIAEALLALVLMDHALRHRAQCGDVRLPVAPIAAHLPDA

aroC

Chorismate synthase

368 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.389 kDa

MSFNTFGHIFRVTTWGESHGPALGATVDGCPPGIAIDAEAIQHWLDRRKPGQNRFTTQRQEPDAVRILSGTFEGRSTGTPIQLMIENTDQRSKDYGEIAQSFRPGHADITYHWKYGLRDYRGGGRSSARETAARVAAGGIARAALSELVPDLRIEGYMVQIGPHAIDRSRIDRAEIERNPFWCPDPDTAALWSDYLDGLRKAHDSVGAIVEIRASGVPAGLGAPIYGKLDSDLAAAMMTINAVKGVEIGEGMAAACLTGSENADEIRMGARGPEFLSNHAGGILGGISTGQDVVVRFAVKPTSSILTPRRSITTDGREVEVVTKGRHDPCVGIRAVPVGEAMMACVLLDHLLLDRGQTGGLRGPIGEA

aroC

Chorismate synthase

368 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

40.007 kDa

MNTFGREFRITTFGESHGKAVGVVIDGVPAGLPLSEEDIKRELERRMFCHIHWLNPRCEPEEFEILSGVKNGHTQGTPIAIVIWNKRAISSYYDELWMKPRPGHADLAYYLKYGKFYDHRGGGRASGRTTAAIVAAGAVAKKLLSQLGVDVCGHIIELGGIEVRRSYTFEEVKSSWAKPLPVVDDEALAAMLETLRKNAAEGDSVGGGVEIWAVGVPPGLGEPHFGKIKAELAMAAFSIPAVVALDWGAGRALAKMRGSEANDPIIIKSGRPALESNKIGGVLGGITVGEPIYFRVWFKPTPSVRKPQRTVDLAKMEPAVLEFKGRYDVSVVPKALVALEAMTAITLADHALRAGLVRRDRPLRDPVV

aroC

Chorismate synthase

368 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.923 kDa

MNTFGRELRITTFGESHGRAIGVVIDGVPAGLPLTEEDIRKELDRRMFCHIHWLNPRCEPEEFEILSGVKDGHTQGTPIAIVIWNKKAISSYYDELWMKPRPGHADLAYYLKYGKFYDHRGGGRASGRTTAAIVAAGAVAKKLLALVGAEVAGHIVELGGVEVKRPYTFEDVKKSWEKPLPVVDDDALAAMLEVLRKNAAEGDSVGGGVEIWAVGVPQGLGEPHFGKIRADLAHAAFSVPAVVALDWGAGRQLAKMRGSEANDPIVVKGGKPGLETNKIGGVLGGITIGEPLYFRVWLKPTPSVRKPQRTVDLAKMEPATLQFKGRYDVSVVPKALVALEAMTAITLADHLLRAGVIRRDRPLKDPVV

aroC

Chorismate synthase

368 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.654 kDa

MNTFGREFRITTFGESHGKAVGVVVDGVPAGLPLSEEDVKRELERRMFCHIPVLNPRCEPEEFEILSGVKEGRTQGTPIAIVIWNRKVISSYYEELWLKPRPGHADLAYYLKYGINYDHRGGGRASGRTTAAIVAAGAVAKAVLRHVGVEVLGHVVELGGVEISATYTVDDVRKSWEKPLPVVDDAALEKMVEKIREAVLRGDSIGGGVEVWALGVPPGLGEPHFGKIKADLAKAAFSIPGVVAFEWGAGRALAKMFGSEANDPITVVNGRPALATNRAGGLLGGITVGAPLYFRAWFKPTPSVRKPQQTVDLGKMEPTTLEFKGRYDVTIVPKALVALEAITAVVLADHVLRAGIIRRDRPISGSLV

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.292 kDa

MSGSSFGSIFKIATWGESHGKGIGVVVDGCPAGLTLNEEMIQTFLNRRKPGQTKYSTPRKEDDLVTILSGVFEGKTTGTPISMMIANETARSADYSEIASFYRPGHADYTFDAKYGFRDYRGGGRSSGRETIGRVAAGAIAAALLKELGIEVFTYTKSIGPIQIDYHKCQKENLTLSPLCMPDLEASQKAEDYLEQCIHNLDSSGGMIECIISGVPAGIGEPVFDKLDAQLAKAIFSIGAVKGFEIGSGFEVAKQLGSENNDGFAFDANGKLIKLTNHSGGILGGISDGSEIIFRAAIKPTPSIKKEQQTVNKSGENINVSIKGRHDPIIVPRAVVVVEAMAALTLADLLLSGMSSKMDYVKKIYQK

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

38.781 kDa

MSFNTFGHLFRVTTWGESHGPALGATVDGCPPGVPITEEALQVWLDKRKPGQNKFTTQRREPDAVEILSGVFEGQSTGSPIQLMIRNADQRSKDYGDIAEKFRPGHADITYWQKYGIRDYRGGGRSSARETAARVAAGGVARAALGALVPDLRITGYMTQMGPHGIDRARFDWEQIDQNPFWTPDAAAAEDWAAYLDGLRKAGSSVGAVIEVTARGVPVGLGAPIYAKLDTDLAAAMMSINAVKAVEIGEGMAAASLTGEANADEIFMGGDGPEYSSNHAGGILGGISTGQDVVVRFAVKPTSSILTTRQTITKSGAPAEIITKGRHDPCVGIRAVPVAEAMMACVLLDHLLLHRGQVGDGPRGAIG

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.241 kDa

MAGNSIGQLFTVTTCGESHGAGLMAIVDGVPPGLALSEADLQIDLDRRKPGTSKYSTQRRESDEVEIISGVFEGKTTGTSIGLLIRNTNQKSKDYSEIKDTFRPGHADYTYSMKYGFRDYRGGGRSSARETAMRVAAGAIAKKYLQDRLGVQIRGHVTQIGNEYSNVAEPSKIDWDFVNSNPFFCADKEAVSRFESLIDNLRREGTSCGARLEVIASGVPVGLGEPVFDRLDADIAHAMMSINAVKGVEIGDGMAVAGQFGHSSRDEMTPDGFTANHAGGILGGISSGQDIRVSIALKPTSSITTAGKSINTQGESVDMLTKGRHDPCVGVRATPIAEAMLAIVLLDHYLRHRGQNADVEQPLASIT

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.191 kDa

MAGNSIGQVFTVTTCGESHGAGLLAIVDGVPPGLALSEADLQIDLDRRKPGTSKYSTQRRESDEVEIISGVFEGKTTGTSIGLLIRNTNQKSKDYGEIKDTFRPGHADYTYSMKYGFRDYRGGGRSSARETAMRVAAGAIAKKYLLERLGVQIRGHVTQIGHEYSDVLNSSTIDWDFVNSNPFFCADADAVSRFETLIDSLRREGTSCGARLEIIASGVPVGLGEPVFDRLDADIAHAMMSINAVKGVEIGDGMAVAGQFGHSSRDEMTPDGFTANHAGGILGGISSGQDIRVSIALKPTSSITTAGKSINTEGEAIEMLTKGRHDPCVGVRATPIAEAMLAIVLLDHYLRHRGQNADIKQPVQSIT

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.139 kDa

MSANSFGKLFTVTTFGESHGPAIGCVVDGCPPGLEIAPEEFTHDLQRRASGKSRHTSARREADEIEILSGVYEGRTTGTPIGLLIRNTDQRSKDYSNIAQQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAGVIAKKWLKQRYGVLVRGFLSQLGEIRPAGFDWDAVEDNPFFWPHAAQVPELETYMDALRKSGDSVGARVDVVAGGVPAGWGEPIYGKLDAELAAALMSINAVKGVEIGDGFASAAQRGTEHRDLITPEGFLSNHAGGILGGISTGQAVTASMVLKPTSSLRLPGATVDADGSVVDVITTGRHDPCVGIRATPIAEAMMALVLMDQALRHRAQCGDVGEVSPRIPGQVDV

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.11 kDa

MSANSFGKLFTVTTFGESHGPAIGCVVDGCPPGLELAPEEFTHDLQRRASGKSRHTSARREADEIEILSGVYEGRTTGTPIGLLIRNTDQRSKDYSNIAQQFRPGHADYTYWQKYGIRDPRGGGRSSARETTMRVAAGVIAKKWLKQRYGVLVRGFLSQLGQIRPAGFDWDAVEDNPFFWPHAAQVPELETYMDALRKSGDSVGARVDVVAGGVPAGWGEPIYGKLDAELAAALMSINAVKGVEIGDGFASAAQKGTEHRDLITPEGFLSNHAGGILGGISTGQAVTASMVLKPTSSLRLPGATVDADGSVVDVITTGRHDPCVGIRATPIAEAMMALVLMDQALRHRAQCGDVGEVSPRIPGQVDV

aroC

Chorismate synthase

367 amino acids

Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system.

Belongs to the chorismate synthase family.

39.138 kDa