araQ

L-arabinose transport system permease protein AraQ

281 amino acids

Part of the binding-protein-dependent transport system for L-arabinose. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the binding-protein-dependent transport system permease family. MalFG subfamily.

31.846 kDa

MLRHSPQFSVYRIALTLFFMMLSLLYLFPIFCLLLGSLKPSSELLRVGLNLDIDPKVMSFDNYTFLFNGGSIYFKWFFNSLVLGLFTTVLTLFFSSMIGYGLAVYDFKGRNIIFVLVLIIMMVPLEVMMLPLFKLTVGLHLIDSYTGVILPFIVSPVAVFFFRQYALGLPRDLLDSARMDGCTEFGIFFRIMAPLMKPAFGAMIILQSLNSWNNFLWPLIVLRSKEMFTLPIGLSSLLSPYGNNYDMLISGSVFAILPVIIIFLFFQKYFISGLTVGGVKG

araQ

L-arabinose transport system permease protein AraQ

279 amino acids

Part of the binding-protein-dependent transport system for L-arabinose. Probably responsible for the translocation of the substrate across the membrane (By similarity).

Belongs to the binding-protein-dependent transport system permease family. MalFG subfamily.

31.365 kDa

MKRKTSPILSWLLTIGFAFIAFIAVFPLLNLILASFRPSTELMRNGITLIFDPSTLTLDNFIYIFTEAGLYWTWFGNSVWISIVIVVLSLLFSSMVGYALAVYDFKGRNFFFLLVLIILMIPFEILMLPLFQLMIKLQLVNTYTAVILPAIVAPIAVFFFRQYALGLPKELMDAARIDGCTEYGIFFKIMLPLMGPSLAAMAILQGLNSWNNFLWPLVVLRSNDMFTLPIGLATLLTPYGNNYDILLAGSVMTIVPIVILFIFFQRYFIAGLTVGGVKG