Function
Receptor for apelin receptor early endogenous ligand (apela) and apelin (apln) hormones coupled to G proteins that inhibit adenylate cyclase activity (PubMed:17336906, PubMed:24316148, PubMed:24407481). Plays a key role in early development such as gastrulation, blood vessels formation and heart morphogenesis by acting as a receptor for apela hormone, promoting endoderm and mesendoderm cell migration and regulating the migration of cells fated to become myocardial progenitors, respectively (PubMed:17336906, PubMed:24316148, PubMed:24407481, PubMed:26017639). Positively regulates angioblast migration toward the embryonic midline, i.e. the position of the future vessel formation, during vasculogenesis (PubMed:26017639). May promote sinus venosus (SV)-derived endothelial cells migration into the developing heart to promote coronary blood vessel development (By similarity). Required for cardiovascular development, particularly for intersomitic vein angiogenesis by acting as a receptor for apln hormone (By similarity). Plays also a role in various processes in adults such as regulation of blood vessel formation, blood pressure, heart contractility, and heart failure (By similarity). Acts redundantly with agtrl1b in heart development (PubMed:17336906).
Sequence
MEPTSEYTETYDYYDTGYNDSGCDYSEWEPSYSLIPVLYMLIFILGLSGNGVVIFTVWRAKSKRRAADVYIGNLALADLTFVITLPLWAVYTALGYHWPFGVALCKISSYVVLVNMYASVFCLTCLSFDRYLAIVHSLSSGRLRSRATMLASLGAIWFLSCLLAVPTLLFRTTVDDTGSNRTTCAMDFSLVTLNQDHESLWIAGLSLSSSALGFLLPFLAMTVCYCFIGCTVTRHFSHLRKEDQKKRRLLKIITTLVVVFAFCWTPFHVLKSMDALSYLDLAPNSCGFLHFLLLAHPYATCLAYVNSCLNPFLYAFFDLRFRSQCLCLLNLKKAMHGHMSSMSSTLSAQTQKSEVQSLATKV