Protein
Autophagy-related protein 3
Organism
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Function
E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of apg-6/atg8. The atg12-apg-4/atg5 conjugate plays a role of an E3 and promotes the transfer of apg-6/atg8 from apg-3/atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of apg-6/atg8. The formation of the apg-6/atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The apg-6/atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).
Similarity
Belongs to the ATG3 family.
Sequence
MNFLRSTAATLLDKYTPVSHTSTFRNTGQITPEEFVAAGDYLTFKFPSWSWADADSPSKRLPFLPPGKQFLVTRHVPCHRRLNDDFAGDAGHEEALVEGNKGGADDDGWLRTGSMTSSQPLRVREVRTVDDAGNVGDREVVDEDDIPDMEDDDDDEAIIRAEGDNSNSGKRTYTLYITYANAYKCPRMYMSGYLSNGQPLPPHLMMEDIVGDYKDKTVTLEDFPFFSHSVKMASVHPCRHASVMKTLLDRADAALKLRREKMKAGQGSGSEQGMEGLVDEINKLDVSGAHANAVEAAPGEDAEWEEVPHDVADQEVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV