alx1

ALX homeobox protein 1

335 amino acids

Sequence-specific DNA-binding transcription factor that binds palindromic sequences within promoters and may activate or repress the transcription of a subset of genes. Most probably regulates the expression of genes involved in the development of mesenchyme-derived craniofacial structures.

Belongs to the paired homeobox family.

37.526 kDa

MDFLTDKFSLKNQPSKAGDFFMGGAGTLEHVMDSMDTESFYSKSPAVVAAAAGASKCVQQGFSAIHRAEHHVRMERASPCQENNANYGLAKVEGQTVHTELGRSMDTCCSLAVSPGKSMADKVELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRADSYPQIQNNLWAGNPSGGSVVTSCMLPREPSSCMTPYSHSSRTDSPYTGFTNHQNQFSHMPLNIFFTESLLSGSANGHSFEAKPEFERRSSSIAVLRMKAKEHTANISWAM

ALX1

ALX homeobox protein 1

328 amino acids

Sequence-specific DNA-binding transcription factor that binds palindromic sequences within promoters and may activate or repress the transcription of a subset of genes. Most probably regulates the expression of genes involved in the development of mesenchyme-derived craniofacial structures (By similarity). May therefore play a role in beak development and regulate beak shape (PubMed:25686609).

Belongs to the paired homeobox family.

37.324 kDa

MIMDFLSEKFALKSQPSKNSDFYMGAGGSLEHVMETLDNESFYSKTSGSKCVQAFNPLQRAEHHVRLERTSPCQDTNVNYGITKVEGQPLHTELSRPMDNCNNLRMSPVKGPQEKGDLDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDVSVLPRTDSYPQIQNNLWAGNAASGSVVTSCMLPRDTSSCMTPYSHSPRTDSGYTGFSNHQNQFSHMPLNNFFTDSLLSGATNGHAFETKPEFERRSSSIAVLRMKAKEHAANISWAM

ALX1

ALX homeobox protein 1

326 amino acids

Sequence-specific DNA-binding transcription factor that binds palindromic sequences within promoters and may activate or repress the transcription of a subset of genes (PubMed:9753625, PubMed:8756334). Most probably regulates the expression of genes involved in the development of mesenchyme-derived craniofacial structures. Early on in development, it plays a role in forebrain mesenchyme survival (PubMed:20451171). May also induce epithelial to mesenchymal transition (EMT) through the expression of SNAI1 (PubMed:23288509).

Belongs to the paired homeobox family.

36.961 kDa

MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM

Alx1

ALX homeobox protein 1

326 amino acids

Sequence-specific DNA-binding transcription factor that binds palindromic sequences within promoters and may activate or repress the transcription of a subset of genes (PubMed:12929931). Most probably regulates the expression of genes involved in the development of mesenchyme-derived craniofacial structures. Early on in development, it plays a role in forebrain mesenchyme survival (PubMed:8673125). May also induce epithelial to mesenchymal transition (EMT) through the expression of SNAI1 (By similarity).

Belongs to the paired homeobox family.

36.931 kDa

MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCVQAFGPLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDASSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM

Alx1

ALX homeobox protein 1

326 amino acids

Sequence-specific DNA-binding transcription factor that binds palindromic sequences within promoters and may activate or repress the transcription of a subset of genes (PubMed:12929931). Most probably regulates the expression of genes involved in the development of mesenchyme-derived craniofacial structures (By similarity). Early on in development, it plays a role in forebrain mesenchyme survival (By similarity). May also induce epithelial to mesenchymal transition (EMT) through the expression of SNAI1 (By similarity).

Belongs to the paired homeobox family.

36.904 kDa

MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCVQAFGPLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELNRAMDGCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNTSGGSVVTSCMLPRDASSCMTPYSHSPRTDSSYTGFSNHQNQFGHVPLNNFFTDSLLTGTTNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM

alx1

ALX homeobox protein 1

320 amino acids

Sequence-specific DNA-binding transcription factor that binds palindromic sequences within promoters and may activate or repress the transcription of a subset of genes. Most probably regulates the expression of genes involved in the development of mesenchyme-derived craniofacial structures (By similarity). Required for proper neural crest cell migration into the frontonasal primordia during development (PubMed:23059813).

Belongs to the paired homeobox family.

36.131 kDa

MEYLSDKFSLKSPAIKGSDYYMDQVMDTLDNVQYYNKASPKCVQAFPMQSNDQHSSMDRSSPCDNQSSVTYCAPKSEESSLHAMENCCSLRVSPATSGPDKTDLDELGEKCDSNVSSSKKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISMLPRTDSYSQISNNLWTGPSAGSSVVSSCMIPRGSPPCVTSPYPHSPRAAEHGYVGFPNHQQNQFGVNHVSLNNFFADSLLASSANSHAAFETKPEFERRSSSIAVLRMKAKEHTANISWAM