albA1

DNA/RNA-binding protein Alba 1

99 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes (By similarity).

Belongs to the histone-like Alba family.

10.772 kDa

MSSTATPTPSNVVLVGKKPVMNYVLAALTLLNQGVSEIIIKARGRAISKAVDTVEIVRNRFLPDKIEVKEIRIGSQVVTSQDGRQSRVSTIEIAIRKKA

albA1

DNA/RNA-binding protein Alba 1

97 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. May be involved in DNA compaction. May bind rRNA and mRNA, playing a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.585 kDa

MSSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK

albA1

DNA/RNA-binding protein Alba 1

97 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. May be involved in DNA compaction. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Belongs to the histone-like Alba family.

10.585 kDa

MSSGTPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVTSQDGRQSRVSTIEIAIRKK

albA1

DNA/RNA-binding protein Alba 1

94 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes (By similarity).

Belongs to the histone-like Alba family.

10.336 kDa

MSIEPQKPNTILVGRKPTINYVMAALKLLNEEGAPEVVIKARGRNICNAVDTVEMLKNLFIKNLVIKKVNIYSESLDSEGKKKVSAIEIVVAKG

albA1

DNA/RNA-binding protein Alba 1

93 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes (By similarity).

Belongs to the histone-like Alba family.

10.381 kDa

MAEEENVVYVGSKPVMNYVLACITQFNEGANEVRIKARGRAISRAVDVAEIVRNRFMPEVEVKDIKIGTEELETEEGDTVNVSTIEIVLEKPV

albA1

DNA/RNA-binding protein Alba 1

89 amino acids

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes (By similarity).

Belongs to the histone-like Alba family.

9.676 kDa

MAENSVFVGNKPVMNYVLAVLTQFNSGATEVSIKARGRAISRAVDVAEIVRKRFLPDVDVKDIKISTEQIDSEQGTANVSAIEIILAKK