ahpD

Alkyl hydroperoxide reductase AhpD

194 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

21.187 kDa

MNLEALLDTVPAYARDLKLNFSAVVRQNTELTEQQLWGTVVACAAASRNRTLLDAIVEEAKGKLSAQAVEAAKGAAAILSMNNIFYRFQHLAVNKKYETMRAGLRMNFLRQHGVDPLDFELWALAVSAVNGCGKCIDAHERVLLQKEFSEEKILAAIRVASTIYGLAVVFDAEEPKGDLVGAPVNTDAYSTTTI

ahpD

Alkyl hydroperoxide reductase AhpD

186 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.414 kDa

MSIEALKARLPDYAKDLRLNLGSVLTTSSLKPGQVWGAAIAAAYAARNDDVTRAIVAEAAQHLDAAGLTAAKAAGAIMGMNNVYYRTVHLSGNADFKKIPARLRMNVIGNPGVEKVDFELWSLAASAVNGCGMCIEAHEREVMHKGMSTENIQDAVRIAAVIHAVATVLDAEAALSGQDGSTAVAA

ahpD

Alkyl hydroperoxide reductase AhpD

186 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.376 kDa

MAALDAIREALPEPARDIKLNLQAVLQPGTLTPAQRWGVAVATAAAARNERLLAAALADARAEVEPAVIEDALAAAAVMAMNNVYYRFRHMVGKASYAEKPARLRMNRLVKPAASKVDFELFALAVSAVNGCETCVRSHEQVVVAGGLSEDQVHEAVRIAAVLHAAAVSLELAGYAAVPSAAAAAG

ahpD

Alkyl hydroperoxide reductase AhpD

186 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.33 kDa

MAALDAIREALPEPARDIKLNLQAVLQPGPLTPAQRWGVAVATAAAARNERLLAAILADARAEVEPAVVEDALAAAAVMAMNNVYYRFRHMVGKPSYSEKPARLRMNRLVKPAASKLDFELFALAVSAVNGCETCVRSHEQVVVGGGVSEDQVHDAVRIAAVVHAAAVALELAGHAAAPSAAAAAG

ahpD

Alkyl hydroperoxide reductase AhpD

186 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.42 kDa

MATLDAIREALPEPARDIKLNLQAVLQPGTLTPAQRWGVAVATAAAARNERLLAAVLADARAEVEPAVVEDALAAAAVMAMNNVYYRFRHMVGKASYAEKPARLRMNRLVKPAASKVDFELFALAVSAVNGCETCVRSHEQVVVAGGLSEDQVHEAVRIAAVLHAAAVSLELAGYAAVPSAAAAAG

ahpD

Alkyl hydroperoxide reductase AhpD

185 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.133 kDa

MSPVDRLREALPDAARDVRLNLQAVLQGGALTEGQRWGVAVASAAAARQPALLSAVLAEARSRGLDSAAEDGLAAAALMAMNNVYYRFRHMVGKPGYTEMPARLRMGRLAQPATSRADLELFSLAASAINGCEACVRTHEDVVVKGGIGEEAVHDAVRIAAVIHAAAVALEAGEVAGGHEAVSAA

ahpD

Alkyl hydroperoxide reductase AhpD

183 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.831 kDa

MPIDTVMETLPGYAKDIKLNYSTLVRQNTELTPQQLWGTVVASAIATRNDTLTAAALEDGAQHLSEQALEAARIAAALMSMNNIFYRFQHLSSNEKYATMPARLRMNGMRTHGVEPVDFELWSLAVSAINGCGKCVDSHEKVLREKGAGEDLVLAAVRVASVIHAIGAVLDAEKVHQPEAAMA

ahpD

Alkyl hydroperoxide reductase AhpD

181 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.931 kDa

MTIEVLKERIPDFAKDVRLNLSSMASDETLGEQTKYGLLVATAIATRNVEVIAAIEAEAAGKLSPAALGAAKSAAAIMAMNNVYYRFVHLASNKDYATMPARLRMNVIANPGVDKADFELWSLAVSAINGCGMCIDSHEKVLLQAGVSTAAIQTAVRFAAIMQSVAVSIEAGAASLAVAAE

ahpD

Alkyl hydroperoxide reductase AhpD

181 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.944 kDa

MSIDALKERIPDFAKDVRLNLSSMASDETLAPQTKYGLFVAAAVATRNPDVIAAMQAVARDNVAPAVIAAAKSAAAIMAMNNVYYRFVHLASNKDYATMPARLRMNVIANPGVDKADFELWSLAVSAINGCGMCIDSHEKVLLAAGVSTAAIQTAVRFAAIIQSVAVSIEAGAADLAMAAE

ahpD

Alkyl hydroperoxide reductase AhpD

181 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.119 kDa

MSIETLKERLPDYAKDLKLNLSSLANDITLSPQQLAGTFVASAIASRNADVTRAIVAEYESVLSPQALTAAKAAAAIMGLNNIYYRFVHMVEGDYAHMPARLRMNVIGRPGVEKLDFELWSLAVSAINGCGMCVESHEKVVREGGLSAEQVQTAVRVAATVHAVAATLDGAAALGDHPAAG

ahpD

Alkyl hydroperoxide reductase AhpD

181 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.933 kDa

MSIEALKTQLPAFAKDVKLNLSALPREDSLTEQQLYGLLVACGYTTRNGTVAQALEAEAAPHLSPAALDAAKAAASIMAMNNVYYRFTHLASNKAYETLPAKLRMSVIGNPGVDKVDFELWSLAVSAMNGCGRCIDAHEAVLREAGLSEAQIQTAVRVGAIIASAAVALEAAGAGFPEAAE

ahpD

Alkyl hydroperoxide reductase AhpD

180 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.114 kDa

MSLETLKTLIPDYAKDIRLNIGSLANETILSEQQKYGCYLASAHAVGEAQTLRAIEAEARGKLSVEALNAAKAASAIMGMNNVYYRATHLVSNTTYTTMPARLRMNVIGNPGVEKVDFELWSLAVSAINGCGMCLDAHEAELRKHGVTSEQIQAAIRIGAVVNAAARVLAAEAALAAEPA

ahpD

Alkyl hydroperoxide reductase AhpD

180 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.172 kDa

MSIDSLKDKLPDFAKDVRLNLSNIANDDTLGEQTKYGLMLACAVATRNAEVLKAFDQECTPHLAPAARDAALAAATIMAMNNVYYRFVHLASNKAYGTLPAKLRMNIIGNPGVPKTDFELWSLAVSAINGCGMCIDSHEKVLLNADTTQDTIQTAVRFAAIIQSTAVALEAASLPVSAAS

ahpD

Alkyl hydroperoxide reductase AhpD

179 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.986 kDa

MSIENLKNSLPEYAKDLKLNLSSIARSTVLNEQQLWGTLLASAAATRSATTLREIAEEAADVLSAEAYNAALGAASIMGMNNVFYRGKAFLGGRYDDLRAGLRMQIIGNPGVDKADFELWSFAVSSINGCAHCLEAHEHTLREAGVSREVIFESLRVAAIVAGVGQAVQSTEALAAAAV

ahpD

Alkyl hydroperoxide reductase AhpD

179 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.105 kDa

MSVENLKNSLPEYAKDLKLNLSSIARTTVLNEQQLWGTLLATAAATKSASTLKEIASEAADNLSAEAYNAALGAASIMGMNNVFYRTKGYLDGKYDDLRAGLRMNIIGNPGVDKADFELWSLAVSAINGCNHCLEAHENTLRQEGVDREVIFEAIRAGSIVAGVAQAVEANEILSAAQV

ahpD

Alkyl hydroperoxide reductase AhpD

179 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.378 kDa

MGVARLRELLPDYAKDLRLNLGSVTSQSQLNNQQLWGTVLTSAIASRGATTLTELEAEALEHLSPEAAKAARTAAALMAMNNVYYRTLHLLEDKEYSRMRAGLRMNAIANPGVDKVDFELWSLAASAVNGCGMCLTAHEHELRGRGVSREVIQDAIRVASVVHAVAVTIESHEQVPATA

ahpD

Alkyl hydroperoxide reductase AhpD

178 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.002 kDa

MSLDSLKSAVPDYAKDLKLNLGSVIGNSDLPAQQLWGTVLATAIASRSPIVLRELEPEAKANLSPEAYSAAKSAAAVMAMNNVFYRTRHLLSDHEYGTLRAGLRMNVIGNPGVDKVDFELWSFAVSAINGCGMCLDSHEQVLRKAGVDRETIQEAFKIAAVVEAVGVTLDAEAVLAAE

ahpD

Alkyl hydroperoxide reductase AhpD

178 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.854 kDa

MSIDSLKGQLPDFAKDVRLNLGSIANDDSLKEQTKYGLLLACALASRNAEVAAAFDREAASHLTPEARDAARAAATIMGMNNVYYRFVHLASNPVYKTMPAKLRMGVIGSPGVPKTDFELWCLAVSAINGCGMCIDAHEKVLADAGVTQEVIQTAVRFAAIVQSAAIALEAAQLPAFA

ahpD

Alkyl hydroperoxide reductase AhpD

178 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.872 kDa

MSVENLKEALPEYAKDLKLNLGSITRTTELNEEQLWGTLLASAAATRNTQVLTEIGAEAADTLSAEAYHAALGAASVMAMNNVFYRGRGFLDGKYDDLRAGLRMNIIGNPGVEKANFELWCFAVSAINGCPDCVASHEHTLREAGVSRETIQEALKAAAIISGVAQAIVTSQTLATAG

ahpD

Alkyl hydroperoxide reductase AhpD

178 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.647 kDa

MSIENLKAALPEYAKDLKLNLGSISRTTVLDEEQLWGTLLASAAATRNAQVLAEIGAEAADNLSAQAYQAALGAVSIMGMNNVFYRGRGFLEGQYDDLRAGLRMNIIANPGVDKANFELWSFAVSSVNGCSHCVVAHEHTLREAGVGREAVLEALKAAAIVCGVAQALTAAQTLAAVG

ahpD

Alkyl hydroperoxide reductase AhpD

178 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.842 kDa

MSVENLKEALPEYAKDLKLNLGSITRTTELNEEQLWGTLLASAAATRNTQVLTEIGAEAADTLSAEAYHAALGAASVMAMNNVFYRGRGFLDGKYDDLRAGLRMNIIGNPGVEKANFELWCFAVSAINGCPDCVASHEHTLREAGVSRETIQEALKAAAIISGVAQAIVASQTLATAG

ahpD

Alkyl hydroperoxide reductase AhpD

178 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.681 kDa

MSIENLKAALPEYAKDLKLNLGSISRTTVLDEEQLWGTLLASAAATRNAQVLAEIGAEAADNLSAQAYQAALGAVSIMGMNNVFYRGRGFLEGQYDDLRAGLRMNIIANPGVDKANFELWSFAVSSVNGCSHCVVAHEHTLREAGVGREAVFEALKAAAIVCGVAQALTAAQTLAAVG

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.157 kDa

MELEQLLNSVPEYAKDLKLNMGGVLRQTELTEQQAWGTAVACAIAARNPQLRESVLGEAAKHLNEQALFAAKAAASVMGMNNIFYRFRHLSTNPKYGAMPARLRMQVIAKHGSDPIDFELWCLAVSAMNGCGVCVDSHENVLREKGVSEEAVLAAIRIASTIHGLAAILDVEADPIA

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

19.022 kDa

MALDELKAAVPDYAKDLRLNLGSVIGNSDLPQQQLWGTVLACAIASRSPRVLRELEPQAKANLSPEAYTAAKSAAAIMAMNNVFYRTRHLLSDPEYGTLRAGLRMNVIGNPGVEKVDFELWSLAVSAVNGCGQCLDSHEQVLRKAGVDRDTIQEAFKIAAVIQAVGTTLDAEAVLAE

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.935 kDa

MALDELKSAIPDFAKDLKLNLGSVIGNSDLPQQQLWGTVLACAIASRSPKVLRELEPEAKANLSAEAYTAAKSAAAIMAMNNVFYRTRHLLSDPEYGTLRAGLRMNVIGNPGVEKVDFELWSLAVSAINGCGQCLDSHEQVLRKAGVDRETIQEAVKVASVIQAVGVTLDAEAVLAE

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.781 kDa

MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.781 kDa

MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.781 kDa

MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.837 kDa

MSIDNIKSALPEYAKDLKLNLGSIANTTELTEQQLWGALVATAAATKNARLLREISEDALDILSEEAYNAALGAAAIMGMNNVFYRTKGQLDGKYDDLRAGLRMNIIGNPGVAKEDFELWSLAVSAINGCGHCLAAHEKTLRDADVARTTIFEAIRLASIVSGVAQALLTADTLAAV

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.781 kDa

MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Together with AhpC, DlaT and Lpd, constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system.

Belongs to the AhpD family.

18.781 kDa

MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS

ahpD

Alkyl hydroperoxide reductase AhpD

177 amino acids

Together with AhpC, DlaT and Lpd, constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system.

Belongs to the AhpD family.

18.781 kDa

MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS

ahpD

Alkyl hydroperoxide reductase AhpD

176 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.401 kDa

MTLDALLQSLPPYAKDVRLNFSSLGREETLTAQQRDGLLVACGLASRNPDLARALEAEAAPRLSPAALAAAKAAATVMAMNNVYYRFTHLASNPAYATRPAKLRMSSIGNPGVARADFELWSLAVSAINGCGRCIDAHEQVLREAGVGEEAIQAAVRVAAVVASLAVALESVRAAA

ahpD

Alkyl hydroperoxide reductase AhpD

175 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.873 kDa

MSIDDLKSKIPDFAKDVRLNLSSMASDETLTPQQKYGLFVACGIASRNADVRKALVAEAAAKVDASVIQAAKSAASIMGMNNVYYRFVHLATNKDYRTMPAKLRMNVIGNPGVDKIDFELWSLAVSAINGCGMCIDAHEDVLRKANVTSETIQTAVRFASIIQSVAIALEAADTE

ahpD

Alkyl hydroperoxide reductase AhpD

175 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.531 kDa

MSIENLKNALPEYAKDLKLNLGSLANEDVLNQQQKAGTFIASALASRSNLVTSAILAEFGPQLSAEALAAAKAAAAIMGMNNVYYRFVHLVGGDYANLPARLRMNVMAKPGVDKVDFELWSLAVSAINGCGMCMESHEKIVRQNGLTQEQVQAAIRIAATVHAVAATLDGEAALS

ahpD

Alkyl hydroperoxide reductase AhpD

175 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.705 kDa

MSIENLKEALPEYAKDLKLNLGTVARGTVLSQSQLWGTLVATAAATRNEQVFKEIREEAAGILTPEALDAALGAASIMAMTNVFYRGRGFLDGAYDDLRPGLRMNIIGNPGVDKSEFELWSFAVSTINGCHYCVGSHEKVLREAGLTREQVLEALKIAAIVAGVAQALATVPALV

ahpD

Alkyl hydroperoxide reductase AhpD

174 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.808 kDa

MSLDSLKSRIPDYAKDLKLNLGSVIGNSGLPAQQLWGTVLSTAIASRSAIVLRELEPEAKANLSPEAYTAAKAAAAVMAMNNVFYRTRHLLSDHEYGNLRAGLRMNVIGNPGVDKVDFEFWSFAVSAINGCGMCLDSTKQVLRKAGVERRSSRRRSDCRGTQAVAATLDAEAFS

ahpD

Alkyl hydroperoxide reductase AhpD

173 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.305 kDa

MSLKEFADALPDYAKDIRLNVGSLLGDQTLTEQRKYGLLLACAHGSGYKPIVEATEAEVAGKLSPEAANAARAAAAVMAMNNVYYRFVHLASNKEYGQMPAKLRMNVIGSPGIEKDDFELFSLAVSAMNGCGLCIDSHEKVLRQHGVAADVIQTAARVGAVIKAAATVHATAV

ahpD

Alkyl hydroperoxide reductase AhpD

173 amino acids

Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity.

Belongs to the AhpD family.

18.569 kDa

MSIDALKNELPEYAKDLKLNLSSLGRETELDDQKKWGTFLASAHAVGEPKTLAAIKAEAETRLSDEALTAAKAASAIMGMNNVYYRFVHLSKNKEYATLPAKLRMNILANPGVDKADFELWSLAVSAINGCGLCIDSHEAELRKHGLTTTQVQAAVRIAATVNAIAAVLAAES