accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

308 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

33.989 kDa

MSWLEKILEKSNLVSSRKASIPEGVWTKCTSCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLDEGERVELGTELEPQDKLKFKDSKRYKERISAAQKSSGEKDALIVMQGELLGMPLVACAFEFSFMGGSMGSVVGARFVKAVEAAIENNCALVCFSASGGARMQEALMSLMQMAKTSAALERLSDKGLPFISVLTDPTMGGVSASLAMLGDINIGEPKALIGFAGRRVIEQTVREDLPEGFQRSEFLLEHGAIDMIVDRREMRQRVGGLVAKLTNHKSPMVVSVNESPNEEPYSVPEADEKG

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

308 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

34.03 kDa

MSWLEKILEKSNLVSSRKASIPEGVWTKCTSCEQVLYHAELERNLEVCPKCNHHMRMKARRRLETFLDEGNRVELGTELEPQDKLKFKDSKRYKERISAAQKSSGEKDALIVMQGELLGMPLVACAFEFSFMGGSMGSVVGARFVKAVEAAIENNCALVCFSASGGARMQEALMSLMQMAKTSAALERLSEKGLPFISVLTDPTMGGVSASLAMLGDINIGEPKALIGFAGRRVIEQTVREDLPEGFQRSEFLLEHGAIDMIVDRREMRQRVGGLIAKMTNHKSPLVVSVNESPNEEPYSVPEVDEKG

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

300 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

32.773 kDa

MKDLFRRAPKRFTAARIENQAIPDNMWVKCPSCGDLIYTRQFSDNLKVCKCGYHMRLTAREWLGLLDDGSFVEFDAALASVDALGFVSPRHVYEQKLIESRQQTGLNDALITSSGAINGMLLCLAVTEFEFIGGSMGSAYGERLARVIERAADARLPLLTINASGGARQEEGTLALLQMAKVNMALTRLAAAGQPHIALLVDPCYGGVLASYTSVADVIIAEPGARVGFAGRRVIEQTIRQKLPVHFQTAEFLLDHGMIDMVTPRSELRGVLSTLLRLYRDAFAHTSAAQHVPALTHVQG

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

298 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

32.329 kDa

MKDLFRRAPKRFTAARIENQAIPDNMWVKCPSCGDLIYTRQFSDNLKVCKCGYHMRLAAREWLGLLDDGSFVEFDAALAPVDALEFISPRHVYAHKLSESQEQTGLNDALITGSGAIEGMPLCVAVTEFEFIGGSMGGAFGERLARIIEQAADARVPLLTINASGGARQEEGTLALLQMAKVNMALTRLAAVGQPHIAVLVDPCYGGVLASYTSVADIIIAEPGARIGFAGRRVIEQTIRQKLPAHFQTAEFLLSHGMIDMVTPRGELRSVLATLLRLFHNAPERAADVQNAPALARA

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

282 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

31.311 kDa

MAIRSLFRKKNEDGQEKGFPEGLMTKCPECRHILLTKELEKNHKVCTKCDHHFKMTAQERVAYFIDEGSFVSMDDHLQTSNPLNFPDYVEKISVAKQQTGLSEAVLTGVGTLDGEEIVVAIMDSHFRMGSMGSVVGEKITRAVEKAIELRVPVIIFTASGGARMQEGILSLMQMVKTSVALKRHSEEGLLFISIMTHPTYGGVSASFASVGDINIAEPQALIGFAGRRVIEETLREKLPNDFQKSEFLLAHGQLDAVFHRKDLRNQVAMLVKMHTKGGVQHV

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

267 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

29.174 kDa

MSHYPASGTWQACPKCGRHVHQRQWGTYQQCPYCHYWQRLTTAQRLEQLVDEGSFQPLTMTERPVNQLGFPDYTNKLRRAQRQTGLNEAVVCGTALIEQQPCILAVMDSHFMMGTLNTAVTRRLLHASEQARAQRLPLIIVTASGGARMQEGVYALVGMNLILAELARLAATPLPLITVLTDPTMGGVSASFAFKGDLIIAEAGAKIGFAGARVIQQTLPVKLPADFQTADQLFKNGMVDAVVERPQLRSTLGQALANYGIGRSAHG

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

267 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

29.232 kDa

MSHYPASGTWQACPKCGRHVHQRQWGTYQQCPYCHYWQRLTTAQRLEQLVDEGSFQPLTMTERPVNQLGFPDYMNKLRRAQRQTGLNEAVVCGTALIEQQPCILAVMDSHFMMGTLNTAVTRRLLHASEQARAQRLPLIIVTASGGARMQEGVYALVGMNLILAELARLAATPLPLITVLTDPTMGGVSASFAFKGDLIIAEAGAKIGFAGARVIQQTLPVKLPADFQTADQLFKNGMVDAVVERPQLRSTLGQALVNYGIGRSAHG

accD1

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta 1

257 amino acids

Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccD/PCCB family.

28.165 kDa

MNINDIFLKRKKRWGIINRLRDSEEQADGSLTPSRRIALISDDKSFRELYAQVKTGNPNSFPGYEQKVEANRLKTGQQDAVVTGTCRIGGVKTAVAVMDKRFLMGSMGIAVGEKITRLTEYAMKRKLPLIIFAASGGARMQEGLFSLMQMAKTTAAIEKFKDAGGLFISYLTNPTTGGVSASFASLGDIIIAEPGALICFAGPRVIEQTIGQKLPEGFQHSEFLLEHGMIDMIVDRKDMKQTLSKILKMHVNTGGEA