acbA

Glucose-1-phosphate thymidylyltransferase

303 amino acids

Probably involved in the biosynthesis of the acarviose moiety of the alpha-glucosidase inhibitor acarbose.

Belongs to the glucose-1-phosphate thymidylyltransferase family.

32.545 kDa

MRGILLAGGTGSRLRPVTWAVSKQLMPVYDKPMIYYPLATLVSCGIREILVITTETEAAQFQRLLGDGSQWGLRLEFAVQQRPGGIAEAFLIGEEFLAGGPVALMLGDNLLHGVDFRPCVQRARETAGGHVFGVAVADPSAYGVVEFDAAGRVLSIEEKPVRPRSPYAVPGFYLYDADVVETARSLRPSARGELEITEVNQAYLRRGALSVTLLGRGAVWLDTGTLADCMRAVDYVRAIDEGQGIKIGCVEEAAWRAGFLDTAQLRALAEPLMSSGYGQYLLALTGDGLSRTPQWPALTAAAG

acbA

Acyl-CoA-binding protein

84 amino acids

Binds to acyl-CoA. Processed into the SDF-2 (spore differentiation factor 2) a peptide which triggers sporulation. SDF-2 appears to stimulate prestalk cells to release additional SDF-2 by acting through a signal transduction pathway that also involves dhkA, regA and PKA. Induces encapsulation of prespore cells in a dhkA-dependent manner. GABA induces the release of acbA from prespore cells and induces the exposure of tagC on the surface of prestalk cells where it can convert acbA to SDF-2. Glutamate acts as a competitive inhibitor and is also able to inhibit induction of sporulation by SDF-2.

Belongs to the ACBP family.

9.431 kDa

MTTFEEAAQKVKEFTKKPSNDELLSLYGLYKQGTDGDCNISEPWAVQVEAKAKYNAWNALKGTSKEDAKAKYVALYEQLATKYA