abi

Abortive infection protein

89 amino acids

ABI may interact with a target in the cell membrane, which could be the product of the host's cmrA gene, and cause disruption of the cellular membrane such that lysis of the infected cell and death of the infecting phage would result.

10.122 kDa

MTKIKTVTFVNTYPGGSMKNLLDTEGTVLFPFQTEIHFIWTIFSTVKRLVIGTRDHICQKQYWSACLCILLLMAYVGLCAAVVWFVVPC