Protein
Monoacylglycerol lipase ABHD2
Function
Progesterone-dependent acylglycerol lipase that catalyzes hydrolysis of endocannabinoid arachidonoylglycerol (AG) from cell membrane. Acts as a progesterone receptor: progesterone-binding activates the acylglycerol lipase activity, mediating degradation of 1-arachidonoylglycerol (1AG) and 2-arachidonoylglycerol (2AG) to glycerol and arachidonic acid (AA). Also displays an ester hydrolase activity against acetyl ester, butanoate ester and hexadecanoate ester. Plays a key role in sperm capacitation in response to progesterone by mediating degradation of 2AG, an inhibitor of the sperm calcium channel CatSper, leading to calcium influx via CatSper and sperm activation (By similarity). May also play a role in smooth muscle cells migration (By similarity).
Similarity
Belongs to the AB hydrolase superfamily. AB hydrolase 4 family.
Sequence
MNTHESEVYTVAPEMPAMFDGMKLAAVATVLYVIVRCLNLKSPTAPPDLTFQDTTLNHFLLKSCPILTKEYIPPLLWGKSGHLQTALYGKLGRVSSPHPFGLRKYLPMQDGATATFDLFEPLADHQSGEDVTMVICPGIGNHSEKHYIRTFVDHSQKQGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFAAMVGFIKKTYPQSKLIVVGFSLGGNIVCKFLGENRTNQERVLCCVSVCQGYSALRAQETFLQWDQCRRFYNFLMADNMKKIILSHRGVLFGVGSKMVDSELSRLYTATSLMQIDDNIMRKFHGHNSLKEYYEKESCVHYIHNINVPLLLVNSVDDPLVHNSLLTIPRTLAEKKENVVFALTLHGGHLGFFEGAVLFPQPLTWMDKVIVDYATAMCQWEKQKPPCQSKDAQSNQTTCQENTS