ZIM17

Mitochondrial protein import protein ZIM17

174 amino acids

Involved in protein import into mitochondria. Acts as a Hsp70-specific chaperone that prevents self-aggregation of the matrix Hsp70 chaperones SSC1 (mtHSP70) and SSQ1, thereby maintaining their function in mitochondrial protein import and Fe/S protein biosynthesis. May act together with PAM18 as co-chaperone to facilitate recognition and folding of imported proteins by SSC1 in the mitochondrial matrix.

19.855 kDa

MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLGSFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK

ZIM17

Mitochondrial protein import protein ZIM17

174 amino acids

Involved in protein import into mitochondria. Acts as a Hsp70-specific chaperone that prevents self-aggregation of the matrix Hsp70 chaperones SSC1 (mtHSP70) and SSQ1, thereby maintaining their function in mitochondrial protein import and Fe/S protein biosynthesis. May act together with PAM18 as co-chaperone to facilitate recognition and folding of imported proteins by SSC1 in the mitochondrial matrix (By similarity).

19.855 kDa

MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLGSFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK

ZIM17

Mitochondrial protein import protein ZIM17

174 amino acids

Involved in protein import into mitochondria. Acts as a Hsp70-specific chaperone that prevents self-aggregation of the matrix Hsp70 chaperones SSC1 (mtHSP70) and SSQ1, thereby maintaining their function in mitochondrial protein import and Fe/S protein biosynthesis. May act together with PAM18 as co-chaperone to facilitate recognition and folding of imported proteins by SSC1 in the mitochondrial matrix (By similarity).

19.855 kDa

MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLGSFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK

ZIM17

Mitochondrial protein import protein ZIM17

174 amino acids

Involved in protein import into mitochondria. Acts as a Hsp70-specific chaperone that prevents self-aggregation of the matrix Hsp70 chaperones SSC1 (mtHSP70) and SSQ1, thereby maintaining their function in mitochondrial protein import and Fe/S protein biosynthesis. May act together with PAM18 as co-chaperone to facilitate recognition and folding of imported proteins by SSC1 in the mitochondrial matrix (By similarity).

19.855 kDa

MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLGSFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK