ZG16

Zymogen granule membrane protein 16

167 amino acids

May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Belongs to the jacalin lectin family.

18.147 kDa

MLTVALLALLCASASGNAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPSSCSRC

Zg16

Zymogen granule membrane protein 16

167 amino acids

May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN (By similarity).

Belongs to the jacalin lectin family.

18.21 kDa

MLAVALLVLLCASASANSIQSRTSSYSGEYGGKGGKRFSHSGNQLDGPITAFRIRVNRYYIVGLQVRYGTVWSDYVGGTQGDLEEIFLHPGESVIQVSGKYKSYVKQMIFVTDKGRYLPFGKASGTSFNAVPLHPNTVLRFISGRSGSAIDSISLHWDTYPSHCNTC

Zg16

Zymogen granule membrane protein 16

167 amino acids

May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Belongs to the jacalin lectin family.

18.213 kDa

MLAIALLVLLCASASANSIQSRSSSYSGEYGGKGGKRFSHSGNQLDGPITAIRIRVNRYYIIGLQVRYGTVWSDYVGGNQGDLEEIFLHPGESVIQVSGKYKSYVKQLIFVTDKGRYLPFGKDSGTSFNAVPLHPNTVLRFISGRSGSAIDAISLHWDTYPSHCNTC