ZFP57

Zinc finger protein 57 homolog

452 amino acids

Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element (By similarity). Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells.

Belongs to the krueppel C2H2-type zinc-finger protein family. ZFP57 subfamily.

51.919 kDa

MAAGEPRSLLFFQKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWRETRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK

Zfp57

Zinc finger protein 57

421 amino acids

Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells. Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element.

Belongs to the krueppel C2H2-type zinc-finger protein family.

47.959 kDa

MAARKQSSQPSRTPVSYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVGSKKKPQEPSSDLQDKNEEQEKSSSCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTNPQSRKGKGYKAQHRGERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKPAASNQAGNQASNQRLKSRVPPTTPRSQAPALKYVKVIQGPVARAKARNSGASTLNVRSNSITVVRSREKISCPYCHITFTMRTCLLTHLKIHFRRQPNQHFCCKESAHSSNTLRMQKIYTCPVCDSSFRGKESLLDHLCCQRPIRFSKCWEILGHLLGYLHEPVVLGNIFKVRDSSGKRMESRRRRRKRACTENPETEGLSGKGRVAPWEMEGATSPESPVTEEDSD

Zfp57

Zinc finger protein 57

406 amino acids

Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells. Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element (By similarity).

46.588 kDa

MAAKKQSKSAKALRTTVRYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVESKKKPQEPNPNLKDKDDDKSSTCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTKPQSRKALGHKPQHRGDRPFFCNLCGKTYRDASGLSRHRRAHVGYRPRSCPECGKCFRDQSEVNRHLKVHQNKKPVAGSHVKVHQNKPVASNQKQKGRVPPTTRESPAPALRHLKVIQGPVARAKARSSRASSLEVRSTSVTVARPREKVYCPYCRITFTMRTCLLNHLKIHFRRQPNQHFCCKESHSSNTLRMQKIYNCPVCDSSFRGKESLLNHLCSRRPIRLSKCWEILGHLLGYLREPLGNIFKVRESRKRRRKRISSDSSETEGPSGSDEVMEVDTDSDLS