Function
Palmitoyltransferase with broad specificity (PubMed:15603741, PubMed:25253725). Palmitoylates JAM3 (By similarity). Palmitoylates SNAP25 and DLG4/PSD95 (PubMed:15603741, PubMed:25253725). Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane and their function in rapid intracellular signaling upon binding of sex hormones (By similarity). May play a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells (By similarity).
Sequence
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSETDMADRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQMRTRKGGPEFSV