About Products Protein Database Contact

YpAngola_A4013

Gene
YpAngola_A4013
Protein
UPF0213 protein YpAngola_A4013
Organism
Yersinia pestis bv. Antiqua (strain Angola)
Length
95 amino acids
Similarity
Belongs to the UPF0213 family.
Mass
10.687 kDa
Sequence
MSDSLWHLYLLRTASGMLYTGITTDVARRLAQHQAGKGAKALRGKGELTLVFHCEAGDRSTALKLEYRVKQLSKQQKEKLVIDQPRLLTTLFLDS