About Products Protein Database Contact

YPDSF_1349

Gene
YPDSF_1349
Protein
UPF0181 protein YPDSF_1349
Organism
Yersinia pestis (strain Pestoides F)
Length
85 amino acids
Similarity
Belongs to the UPF0181 family.
Mass
9.72 kDa
Sequence
MLAGMPSLSHEEQQEAVERIHKFMSEGMSSGEAIALVAAEIRERHQNDPQAMAIFEDHDFDEHTESDYRRDDEPDADDIEDPYEG