About Products Protein Database Contact

YPDSF_1039

Gene
YPDSF_1039
Protein
UPF0260 protein YPDSF_1039
Organism
Yersinia pestis (strain Pestoides F)
Length
148 amino acids
Similarity
Belongs to the UPF0260 family.
Mass
17.175 kDa
Sequence
MSQPPFWQQKTLAEMSDSEWESLCDGCGQCCLNKLIDEDTDEIYFTNVACDQLNIKTCQCSNYERRFELEEDCIKLTRENLVTFAWLPPTCAYRLIGEGHDLPRWHPLLTGSKAAMHGERISVRHIAVRESEVVDWQDHILNKPSWAK