YNG2

Chromatin modification-related protein YNG2

298 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis (By similarity).

Belongs to the ING family.

33.72 kDa

MDTSTVLEKYTQDLSNLPLEVRHLLEEIKSKDVQVSEARKRYQTRDHQLHKFIRTNGTLTKHPKEDQLYSKIEEDMKLVQKLQKEKILLANTALFLISKHLYHFETDIAKLERDELLPPLEHPIELTEVSKDEYAKSLNGFSDSASATPTPRNGSSATPVAETVKKIQKKKLSVKGASSSSAQSSSASRQVKRLRSEEIEDPLPYEGGSLAFNGNVAMSINSAADANGPNGEDADNNLYCFCQRVSFGEMIGCDNEDCKYEWFHWSCVGITSPPKDDEIWYCPDCASKMEKRKKKRKN

YNG2

Chromatin modification-related protein YNG2

295 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis (By similarity).

Belongs to the ING family.

32.764 kDa

MSSINERPQDPSSALEQATQDVANLKSEFHHIMDEMQVADKTLVSSREQYLREDYVLHKLVKQHGSLTKDPKEGSITETVEKEMKRCGDLQQQKCILANTALYLVTKHLSKIKANIESLEEDGLLAPLDDELSDKKAGSVDLGAGIAGLGNGTAGSGSSSGRKRPASSSSANGKGQKRKQQKKERSRSHQRAGTVSRDVSPNAGIGRDPTFDALAYNDDLFKMNQGGEEDDKQLYCFCQRVSYGEMVACDGPNCKYEWFHYSCVNLTEPPKGQWYCPECRLEIANQKLNKKKKKQ

YNG2

Chromatin modification-related protein YNG2

285 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis (By similarity).

Belongs to the ING family.

32.585 kDa

MSFERPQDPSSALEQATQDVSNLKSESRFLLEEIRASDLEFYESKKRFLNKDTQIHKFIKQHGSLVDNPKEAEFQERIKEDLERCHQLQVDKCTVANSLLYMVTKHLKKVQANIEALEEDGLLAPLEDDAVELANELSRESSVLSSGTSLERRKRTVAAGTLSAGSSLRKRVKKERGRSTQRDGMLSEPPSDEASSHGANFADDLQDFNDELFSLNQQEEDDKQLYCFCQSVSYGEMVACDGPNCKYEWFHYGCVNLDEPPKGQWYCPECRQEMANLKLKKKKRV

YNG2

Chromatin modification-related protein YNG2

285 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis (By similarity).

Belongs to the ING family.

32.437 kDa

MDTTTVLDKYTQDLSNLPLEVKHLLQELKNKDVQLQEARKRYQTKDNQIHKFIRANGTLTKHPKEQQIYNKVEEDMVLVKKLQKEKILLANTALFLVSKHLSNFETDIAKLEKDELLPPVDNVMELDTPSSDMNSVINGLSDNLSGTTTPRGHSASTPVADNAANSMLRKAQKRKHALGMKGASGLTRPSKRMKSEDFEDKKYDNDSLSRPNEGPGNNGEDADNNLYCFCQRVSFGEMIGCDNDDCKFEWFHWSCVGITAPPKDDEIWYCPDCAPKMEKRKKKRK

YNG2

Chromatin modification-related protein YNG2

283 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis (By similarity).

Belongs to the ING family.

31.201 kDa

MDAASVLDQYVQDLANLPSEVAHILEEVRDKDLKFYETRKRIQQRDNQIHKFIRANGSLAENPKEQAAYPKIRQDFQTAMELQDEKCTLAAQALTLVAKHVKKLNDDIDKLDAEGLLGGAPPQKPISANRSRATSSATPAPEPPSRNYTRDRANSRRGGSPAASRSSTPGTRPPKKRATDKNNEAASMSKESSVGASEQLRNMPETVAVGSLDAAIRAGPGEDDEVLYCFCQQPSFGEMVACDNDDCQYEWFHYDCVGLAEPPQGVWFCPSCSKGRKGDKKKR

YNG2

Chromatin modification-related protein YNG2

282 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis.

Belongs to the ING family.

32.086 kDa

MDPSLVLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEQKESQIHKFIRQQGSIPKHPQEDGLDKEIKESLLKCQSLQREKCVLANTALFLIARHLNKLEKNIALLEEDGVLAPVEEDGDMDSAAEASRESSVVSNSSVKKRRAASSSGSVPPTLKKKKTSRTSKLQNEIDVSSREKSVTPVSPSIEKKIARTKEFKNSRNGKGQNGSPENEEEDKTLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIEMEKNKLKRKRN

YNG2

Chromatin modification-related protein YNG2

274 amino acids

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis (By similarity).

Belongs to the ING family.

31.768 kDa

MDPSLLLDQMLQDVSNLPAEFRYMLEEVGLEDEQCLELRKRYQQKEGILHKYIKQNGSLAANPKEDELLAEVEQSMAQVRELQEEKCQRANTILFLVSRHLNKLQQNIIMLEEDGLLAPAEDEMESGPDFSRESSVVGSTVSERKRKAASEDHPRRKKQSRSMSNTHREKSYNKGDDTADVKSPASTEREGTLDLQNYQEELFSSMNDNEKEDQNLYCFCQRVSFGEMVACDGPNCKYEWFHYECVNLTEPPKGTWYCPDCKQEMSKKLKKKKQ