About Products Protein Database Contact

YIL141W

Gene
YIL141W
Protein
Putative uncharacterized protein YIL141W
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
129 amino acids
Mass
14.438 kDa
Sequence
MFPLRAVLEPCLKNVIIPIVGMVKDSISTTSKLLAESRPPLSSNFHFSYENLFSYSLLSHPVVIDTATATITRRTEQLLNRKIISSSKRFPASNIYVYQEAFTYHDTASDFIIADSYYITTPSSSGHAL